KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1582Help
Entry
NMB1582           CDS       T00027                                 

Gene name
hisC
Definition
(RefSeq) histidinol-phosphate aminotransferase
  KO
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    NMB1582 (hisC)
   00350 Tyrosine metabolism
    NMB1582 (hisC)
   00360 Phenylalanine metabolism
    NMB1582 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB1582 (hisC)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    NMB1582 (hisC)
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     NMB1582 (hisC)
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class II
   NMB1582 (hisC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1644443..1645540
Genome map
AA seq 365 aa AA seqDB search
MKSVRSFIRDDIQAMSAYQIADVPPGFAKLDSMESPVHPFAGHETLLQEWQARLAAAPIH
LYPNPSGSGLQEALRSAFDIPDCADIALGNGSDELIQFITMLTAKPGAAMLAAEPSFVMY
RHNAALYGMDYVGVPLNGDFTLNLPAVLEAVRKHRPALTFIAYPNNPTGVCFTRAEIEAV
IEASDGIVVVDEAYGAFNGDSFLPQAGRIPNLIVLRTLSKIGFAGLRIGYAAGCPEVIGE
LQKILPPYNMNQLSLTTAKLALRHYGIISANIDSLKNERERMFAELGKICRLNTFSSQAN
FITIRVPDADLLFDTLKQNRILVKKLHGAHPLLEHCLRITVGSPAQNDAVLNIIRQLYCQ
PTDFL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgtccgctccttcatccgcgacgacatacaagctatgtcggcatatcagatt
gccgacgttccgcccggctttgccaaactcgattcgatggaaagtcccgtccaccctttt
gccggacatgaaacgctgttgcaggaatggcaggcacggcttgccgccgcgcccatccat
ctttaccccaatccctccggcagcggtttacaggaagcattacgttcggcgttcgacatt
cccgactgcgccgacatcgcgctgggcaacggttcggacgaactgatacagttcatcacg
atgctgaccgccaaaccgggcgcggcaatgttggcagccgaacccagtttcgtcatgtac
cgccacaacgccgcgctgtacggcatggattatgtcggcgttccactgaacggagatttc
accctcaacctgcccgccgtcctcgaagccgtcaggaaacaccgccctgccctgaccttt
atcgcctaccccaacaaccccaccggcgtatgcttcacgcgtgccgaaatcgaagccgtc
atcgaagcttcagacggcatcgtcgtcgtcgatgaagcctacggcgcattcaacggcgac
agcttcctgccgcaggcaggcaggattcccaacctgatagtcttacgcaccctcagcaaa
atcggttttgccggactgcgtatcggttatgcggcaggctgccccgaagtcatcggcgaa
ctgcaaaaaatcctgccgccctacaatatgaaccaattgagcctgaccactgccaaactc
gccctgcggcactacggcattatctctgccaacatcgacagcctgaaaaacgaacgcgaa
cggatgttcgccgaattgggcaaaatatgccgtctgaacaccttttcaagtcaggcaaac
ttcattaccatacgcgtacccgatgccgatttgttgtttgacacgctcaaacaaaaccgc
atcttggttaaaaaactgcatggcgcgcacccgcttttggaacactgcctgcgcattacc
gtaggcagccccgcacaaaacgatgccgttctcaacatcattcgccaactttactgccaa
ccaacggatttcctatga

DBGET integrated database retrieval system