KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1588Help
Entry
NMB1588           CDS       T00027                                 

Gene name
pgsA
Definition
(RefSeq) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NMB1588 (pgsA)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     NMB1588 (pgsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1650954..1651517)
Genome map
AA seq 187 aa AA seqDB search
MPWNLPIFLTWLRVLLIPVLTALFYLPFPWFAEETINLTAAVIFAVAALTDWFDGFLARL
WKQTSDFGAFLDPVADKLMVAVSLLLLVKLDRTYVLFAMIIIGREITISALREWMAQMGK
RNSVAVATVGKFKTAAQMLAIFLLLLNFPDFYGFNLAFIGNVLMFIASLLTVWSMLYYLK
MAWKEIA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgccttggaatctccccatcttcctcacatggttgagggtcttgctcattcctgtcctg
acagcccttttttacctgccttttccgtggttcgcggaggaaacgattaatctcaccgcc
gccgtcatttttgccgttgccgccttgaccgactggtttgacggatttttggcaaggttg
tggaaacagacctcggatttcggcgccttcctcgatcccgttgccgacaagctgatggtc
gccgtctctttgcttttactggtcaaactcgaccggacctatgttttgtttgccatgatc
atcatcggcagggaaattaccatttccgcattgcgcgaatggatggcgcaaatgggcaaa
aggaacagcgttgccgtcgccaccgtcggtaagtttaaaaccgccgcgcaaatgctggca
atcttcctgctgctgctgaattttcccgatttttatggatttaacctcgcattcatcggc
aatgtattgatgtttatcgcatctttgctgacagtctggtcgatgctgtattatctgaaa
atggcgtggaaagaaatcgcctga

DBGET integrated database retrieval system