KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1603Help
Entry
NMB1603           CDS       T00027                                 

Definition
(RefSeq) potassium-tellurite ethidium and proflavin transporter
  KO
K03304  
tellurite resistance protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   NMB1603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1663327..1664271
Genome map
AA seq 314 aa AA seqDB search
MSASKKFPIPLSYFSIALGLFALGLSWRYGASVGLLPALAAESLLAAASVVWLLLVAAYL
IKMFAYRNDFLSDLRDLVQCCFISAIPITAMLEGLALKPYQAGAAAVLIYVGVAGQLAFS
MYRAAGLWRGLHSLEATTPIIYLPTVATNFVSASSLAALGHHDYAALFFGAGMFSWLSLE
ASILGRLRTAAPVGTAARGVVGIQLAPAFVGCGAYFAVGGKVDGFALALIGYGCLQLLFL
LRLTRWFWEGGFTMSFWGFSFGFAAMAGCGLHLAASGVLSGLGLTLATAGSAGVALLLVG
TLHRIATGRFLVRS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcatctaagaaatttccgattcctttgagctatttcagcatcgcgctgggcttg
tttgccttggggctgtcgtggcgttacggcgcgtctgtcgggctgctgcccgccttggcc
gccgaatcgctgcttgcggcggcttcggtcgtctggctcttgctggtggcggcatacctg
atcaaaatgtttgcgtaccgaaacgattttttgtctgatttacgcgacttggtgcaatgc
tgcttcatcagcgcgattccgattaccgctatgctggagggactcgcgctgaagccctat
caggcaggcgcggcggcagtcctgatttatgtcggcgttgccggacagttggctttttcg
atgtatcgggcggccggtctgtggcgcggcctgcattccttggaggcgacgacgccgatt
atttatctgcctacggttgcgacaaactttgtcagcgcgtcatctctggcggcgttgggg
catcatgattatgcagctttgtttttcggcgcgggtatgttttcctggctgagcttggaa
gcctccatcttgggcaggctgcgcacggcggcaccggtcggcacggcggcgcgcggcgtg
gtcggcatccagcttgcgcccgcctttgtcggctgcggcgcgtattttgccgtcggcggt
aaagtcgacggttttgcgttggcattaatcggctacggctgcctgcagcttttgttcttg
ctgcgcctgacccgctggttttgggaaggtggttttacgatgagcttttggggattttca
ttcggtttcgcggcaatggcaggatgcggtctgcatctggcggcttccggcgtattgtcg
ggcttggggctgacgcttgccaccgccggatcggcaggcgtggcgctgctgcttgtcggt
acgctgcaccggatagcgacggggcgtttcttggtacgcagctga

DBGET integrated database retrieval system