KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1604Help
Entry
NMB1604           CDS       T00027                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1604 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    NMB1604 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1604 (gpmA)
Enzymes [BR:nme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NMB1604 (gpmA)
Membrane trafficking [BR:nme04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NMB1604 (gpmA)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NMB1604 (gpmA)
  Exosomal proteins of melanoma cells
   NMB1604 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1664344..1665027)
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKENGYEFDIAFTSVLTRA
IKTCNIVLEESDQLFVPQIKTWRLNERHYGQLQGLDKKQTAEQYGDEQVRIWRRSYDTLP
PLLDKDDEFSAHKDRRYAHLPADVVPDGENLKVTLERVLPFWEDQIAPAILSGKRVLVAA
HGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYKLDDNLKVIEKFYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaactggtatttatccgccacggacaaagcgaatggaacgcgaaaaacctgtttaca
ggctggcgcgacgtgaagctgagcgagcaggggcttgccgaggctgccgccgccggcaag
aaactgaaagaaaacggctatgagttcgacatcgccttcacatccgtcctgacccgcgcg
attaagacctgcaacatcgttttggaagaatccgaccaactgttcgtaccgcaaatcaaa
acgtggcggctgaacgaacgccactacggccaactgcaaggcctggacaaaaaacaaacc
gccgaacaatacggcgacgagcaagtccgcatctggcggcgcagctacgacaccctgccg
ccgcttttggacaaagacgatgagttttccgcacacaaagaccgccgctatgcccatctg
cctgccgatgtcgtacccgacggcgaaaacctgaaagtaacgctggagcgcgtattgccg
ttttgggaagaccaaatcgcccccgcgattttgagcggcaaacgcgtcttggtggcggcg
cacggcaactccctgcgcgcgctggcaaaacacatcgagggcatttccgacgaagacatt
atgggcttggaaatcccgaccggtcagccgttggtgtacaaattggacgacaatttgaaa
gtcatcgaaaaattctacctgtaa

DBGET integrated database retrieval system