KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1604Help
Entry
NMB1604           CDS       T00027                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1664344..1665027)
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKENGYEFDIAFTSVLTRA
IKTCNIVLEESDQLFVPQIKTWRLNERHYGQLQGLDKKQTAEQYGDEQVRIWRRSYDTLP
PLLDKDDEFSAHKDRRYAHLPADVVPDGENLKVTLERVLPFWEDQIAPAILSGKRVLVAA
HGNSLRALAKHIEGISDEDIMGLEIPTGQPLVYKLDDNLKVIEKFYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaactggtatttatccgccacggacaaagcgaatggaacgcgaaaaacctgtttaca
ggctggcgcgacgtgaagctgagcgagcaggggcttgccgaggctgccgccgccggcaag
aaactgaaagaaaacggctatgagttcgacatcgccttcacatccgtcctgacccgcgcg
attaagacctgcaacatcgttttggaagaatccgaccaactgttcgtaccgcaaatcaaa
acgtggcggctgaacgaacgccactacggccaactgcaaggcctggacaaaaaacaaacc
gccgaacaatacggcgacgagcaagtccgcatctggcggcgcagctacgacaccctgccg
ccgcttttggacaaagacgatgagttttccgcacacaaagaccgccgctatgcccatctg
cctgccgatgtcgtacccgacggcgaaaacctgaaagtaacgctggagcgcgtattgccg
ttttgggaagaccaaatcgcccccgcgattttgagcggcaaacgcgtcttggtggcggcg
cacggcaactccctgcgcgcgctggcaaaacacatcgagggcatttccgacgaagacatt
atgggcttggaaatcccgaccggtcagccgttggtgtacaaattggacgacaatttgaaa
gtcatcgaaaaattctacctgtaa

DBGET integrated database retrieval system