KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1609Help
Entry
NMB1609           CDS       T00027                                 

Definition
(RefSeq) O-succinylhomoserine sulfhydrolase
  KO
K10764  
O-succinylhomoserine sulfhydrylase [EC:2.5.1.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NMB1609
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB1609
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.-  
     NMB1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1671729..1672898)
Genome map
AA seq 389 aa AA seqDB search
MSKKLHPQTLAIRGGKEQTEYREHNQALFLTSSFMWDNAQHAADLFSKKIKGFTYTRTAN
PTTAAFEKRIAALEGAERAVATSAGMSAIQAAFFTFLQAGDHVISSRSLFGTTVGFINNI
VAKFGIEVSHVSPTDINEWKAAVKANTKLLFLETPSNPLGEVADLEALAELAHGIGALLV
VDNSLLSPVGSQPLKHGADISVSSATKAIDGHGRVMGGVLAGSEELLAQVAMYCNSCGLA
MSPFNAWQLLSGVETLSLRMEKQFDNALKIAQWLQAQPQVQAVYYTGLSDHPQAALIRKQ
QNGGGIVIGFEVADQEAAWKVVDGVELFSRTANLGDVRSTITHPWTTTHGRMQPEEKLAA
NIRPGLVRLSVGLEYVGDLIDDLKQALAR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaactccatccgcaaacgctcgccatacgcggcggcaaagaacaaaccgaa
taccgcgaacacaatcaggcattgtttctgaccagcagcttcatgtgggacaacgcccaa
cacgctgccgatttgttttcaaaaaaaatcaaagggttcacttatacccgtaccgccaac
ccgaccacagccgcctttgaaaaacgcatcgccgctttggaaggtgcggaacgcgcggtc
gccacttcggcgggtatgtctgcgattcaggcggcgtttttcacctttttgcaggcgggc
gaccatgtgatttccagccgcagcctgttcggcacgaccgtcggctttatcaataacatc
gttgccaaattcggcatcgaagtgagccacgtgtcgccgactgatataaacgaatggaaa
gccgccgtcaaagccaataccaaactgctgtttttggaaacgccgtccaaccccttaggc
gaagtggccgacttggaagccttggcggaattggcgcacggcatcggcgcgctcttggtg
gtggacaacagcctgctgtcgcccgtcggctcgcagcctttgaaacacggtgcggatatt
tccgtttcctccgcgaccaaagccatagacggacacgggcgtgtgatgggcggcgtgttg
gcgggttcggaagagttgttggcgcaggtcgccatgtattgcaactcttgcgggctggcg
atgtcgccgtttaatgcgtggcagttgttgagcggcgtggaaaccctgtcgctgcgtatg
gaaaaacagttcgacaacgccctgaaaatcgcacaatggctgcaagcgcagccgcaggtt
caagccgtgtactacaccggattgtccgaccatcctcaggcggcgcttatccgcaaacag
caaaacggcggcggcatcgtcatcggctttgaagttgccgatcaagaagcggcgtggaaa
gttgtggacggcgtggaactcttttcccgcaccgccaacctcggtgacgtgcgctcgacc
attacccacccgtggacaaccacgcacggcaggatgcagcccgaagaaaaactcgccgcc
aacatccgccccggattggtgcgcctgtcggtcggtttggaatatgttggcgatttgatt
gacgatttgaaacaggcactcgcacgctga

DBGET integrated database retrieval system