KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1613Help
Entry
NMB1613           CDS       T00027                                 

Gene name
fumB
Definition
(RefSeq) fumarate hydratase
  KO
K01676  
fumarate hydratase, class I [EC:4.2.1.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1613 (fumB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMB1613 (fumB)
   00620 Pyruvate metabolism
    NMB1613 (fumB)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     NMB1613 (fumB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1675320..1676843
Genome map
AA seq 507 aa AA seqDB search
MTVIKQEDFIQSICDAFQFISYYHPKDYIDALYKAWQKEENPAAKDAMTQILVNSRMCAE
NNRPICQDTGIATVFLKVGMNVQWDADMSVEEMVNEGVRRAYTWEGNTLRASVLADPAGK
RQNTKDNTPAVIHMSIVPGGKVEVTCAAKGGGSENKSKLAMLNPSDNIVDWVLKTIPTMG
AGWCPPGILGIGIGGTPEKAVLMAKESLMSHIDIQELQEKAASGAELSTTEALRLELFEK
VNALGIGAQGLGGLTTVLDVKILDYPTHAASKPIAMIPNCAATRHVEFELDGSGPVELTP
PRVEDWPDLTYSPDNGKRVDVDKLTKEEVASWKTGDVLLLNGKILTGRDAAHKRLVDMLN
KGEELPVDFTNRLIYYVGPVDPVGDEVVGPAGPTTATRMDKFTRQMLEQTDLLGMIGKSE
RGVATCEAIADNKAVYLMAVGGAAYLVAKAIKSSKVLAFPELGMEAIYEFEVKDMPVTVA
VDSKGESIHATAPRKWQAKIGIIPVES
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcatcaaacaggaagactttatccaaagcatttgcgatgccttccaattcatc
agctactatcatcccaaagactacatcgacgcgctttataaggcgtggcagaaggaagaa
aatcctgccgccaaagacgcgatgacgcagattttggtcaacagccgtatgtgtgcggaa
aacaaccgccccatctgccaagacacaggtatcgcaaccgtcttcctcaaagtcggtatg
aacgtccaatgggatgcggacatgagcgtggaagagatggttaacgaaggcgtacgccgc
gcctacacttgggaaggcaatacgctgcgcgcttccgtcctcgccgatccggccggcaaa
cgccaaaacaccaaagacaacacccccgccgtcatccatatgagcatcgtgccgggcggt
aaagtcgaagtaacctgcgcggcaaaaggcggcggctctgaaaacaaatccaaactcgcc
atgctcaatccttccgacaacatcgtcgattgggtattgaaaaccatcccgaccatgggc
gcgggctggtgtcctcccggcatcttgggtatcggcatcggcggcacgcccgaaaaagcc
gtgctgatggcaaaagagtccctgatgagccacatcgacattcaagaattgcaggaaaag
gccgcgtccggcgcggaattgtccaccaccgaagccctgcgcctcgaactctttgaaaaa
gtcaacgcgctgggcatcggcgcacaaggcttgggcggactgaccaccgtgttggacgtg
aaaatcctcgattatccgacccacgccgcctccaaaccgattgccatgattccgaactgc
gccgccacccgccacgtcgaatttgaattggacggctcaggccctgtcgaactcacgccg
ccgcgcgtcgaagactggcccgatttgacttacagccccgacaacggcaaacgcgtcgat
gtcgacaagctgaccaaagaagaagtggcaagctggaaaaccggcgacgtattgctgttg
aacggcaaaatcctcaccggccgcgatgccgcacacaaacgcctcgtcgatatgctcaac
aaaggcgaagaattgcccgtcgatttcaccaaccgcctgatttactacgtcggccccgtc
gatccggtcggcgatgaagtcgtcggtccggcaggtccgaccacagccacccgcatggac
aaattcacccgccaaatgctcgaacaaaccgacctcttgggcatgatcggcaaatccgag
cgcggcgtggccacctgcgaagccatcgccgacaacaaagccgtgtacctcatggcagtc
ggcggcgcggcgtatctcgtggcaaaagccatcaaatcttccaaagtcttggcgttcccc
gaattgggcatggaagccatttacgaatttgaagtcaaagacatgcccgtaaccgtcgcc
gtagatagcaaaggcgaatccatccacgccaccgccccgcgcaaatggcaggcgaaaatc
ggcatcatccccgtcgaatcttga

DBGET integrated database retrieval system