KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1616Help
Entry
NMB1616           CDS       T00027                                 

Gene name
thiD
Definition
(RefSeq) phosphomethylpyrimidine kinase
  KO
K00941  
hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NMB1616 (thiD)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     NMB1616 (thiD)
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     NMB1616 (thiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1679793..1680599
Genome map
AA seq 268 aa AA seqDB search
MKSSFVQTLTIAGSDSGGGAGIQADLKTFQMRGVFGTCVITAVTAQNTLGVSAVHLVPTE
TITAQIQAIREDFDIRAYKIGMLGTAEIIECVADKLKHCSFGRRVLDPVMIAKGGAPLLQ
DSAVAALTRLLLPDTDVLTPNLPEAEALTGVHIENRKDAERAAKILLDYGVKNVVIKGGH
LNGSTSGRCTDWLFTQNETLEFDSPRFPTAHTHGTGCTFSACITAELAKGSDVCEAVQTA
KAYITAAISNPLEIGAGHGPVNHWAYRD
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctcttttgtgcaaacgcttaccatcgccggttcggattcgggcggcggtgcg
ggcattcaggcggatttgaaaacatttcagatgcgcggcgtgttcggaacgtgcgtcatc
accgccgttaccgcgcaaaataccttgggcgtgtcggcggttcatctcgtcccgaccgaa
accatcaccgcacaaatccaagcaatcagggaagacttcgacatccgcgcctacaaaatc
ggtatgctcggcacggcggaaatcatcgaatgcgttgccgacaagctgaaacactgcagc
tttggcaggcgcgtactcgaccctgtgatgattgccaaaggcggtgcgccgctgttgcag
gattccgccgttgcggcactgacgcgcctgctgcttcccgatacggatgtattgaccccc
aacctgcccgaagcggaagctctgaccggcgtgcatattgaaaaccgtaaagatgcggaa
cgtgcggcaaaaatcctgcttgattacggtgtcaaaaatgtcgttatcaaaggcggacat
ttgaacggcagcacaagcggacgctgcacggattggctgtttacacaaaatgaaacgctg
gaattcgacagcccgcgctttccgaccgcccacacgcacggcacgggctgcacgttttcc
gcctgcatcaccgccgagttggcaaaaggctcggacgtttgcgaagccgtacagactgcc
aaggcctacatcacggcggcaatctcaaaccctttggaaatcggcgcaggacacggcccg
gtcaatcattgggcgtatcgggactaa

DBGET integrated database retrieval system