KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1622Help
Entry
NMB1622           CDS       T00027                                 

Gene name
norB
Definition
(RefSeq) nitric oxide reductase
  KO
K04561  
nitric oxide reductase subunit B [EC:1.7.2.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    NMB1622 (norB)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.5  nitric oxide reductase (cytochrome c)
     NMB1622 (norB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1685330..1687585)
Genome map
AA seq 751 aa AA seqDB search
MGQYKKLWYLLFAVLAVCFTILGYMGSEVYKKAPPYPEQVVSASGKVLMTKDDILAGQSA
WQTTGGMEVGSILGHGAYQAPDWTADWLHRELVAWLDLTAQQTYGKKFDEVSPEEQAVLK
TRLADEYRNQSRVKEDGSVVISDTRVKAIESILPYYHGVYSDDPKFQTTREHFAMKNNTL
PSQEAREKLFNFFFWTSWSASTNRPDENFTYTNNWPHEPLINNVPTTENYMWSFTSVVLL
LMGIGLLMWGYSFLTKHEEVEVPSEDPISKIQLTPSQKALGKYVFLTVALFVVQVLLGGL
TAHYTVEGQGFYGIDEALGFEMSDWFPYALTRTWHIQSAIFWIATGFLTAGLFLAPIVNG
GKDPKFQRAGVNFLYIALFIVVGGSYAGNFFALTHILPPEFNFWFGHQGYEYLDLGRFWQ
LLLMVGLLLWLFLMLRCTVSAFKEKGVDKNLLAIFVASMVGVGVFYAPGLFYGEKSPIAV
MEYWRWWVVHLWVEGFFEVFATAAFAFVFYNMGFVRRSTATASTLAAAAIFMLGGVPGTL
HHLYFSGSTSASMAIGACFSALEVVPLVLLGREAYEHWSYQHLSDWAKRLRWPLMCFVAV
AFWNMIGAGVFGFLINPPISLFYIQGLNTSAVHAHAALFGVYGFLALGFVLLVARYLKPN
AQFDDKLMTWGFWLLNGGLAGMIAISLLPVGAIQAYASITHGLWYARSEEFLQMEILDTL
RWVRTAADLVFIGGAICVAIQATKIVFGRDK
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgggacagtacaagaagctttggtacttgctgtttgccgttctggcggtatgctttacc
attcttggctatatgggcagcgaggtttacaaaaaagccccgccttaccccgaacaggtc
gtttccgcatccggcaaggtcttgatgacgaaagacgatattttggcaggtcagtctgca
tggcagactaccggcggtatggaagtcggttcgattttgggtcacggtgcatatcaggct
ccggactggacggcggactggctgcatcgtgagttggttgcctggttggatttgaccgcg
caacagacttacggcaaaaaattcgacgaggtttcccccgaggaacaagccgtcttgaaa
acacgcctggccgacgaataccgcaatcaaagccgcgtgaaggaagacggcagcgtcgtc
atcagcgatacgcgcgtgaaagccatcgaaagcatcctgccttactaccacggtgtgtac
agcgacgatcctaagttccaaaccactcgcgaacactttgcaatgaaaaacaatacattg
ccaagccaagaagcgcgtgaaaaactgttcaacttcttcttctggacttcttggtctgct
tcgaccaaccgtcctgacgagaattttacttacaccaacaactggccgcacgaacctttg
atcaacaacgtaccgaccactgaaaactatatgtggtcattcaccagcgttgttcttctg
ctgatgggcatcggtttgctgatgtggggttattccttcctgaccaaacacgaggaagtg
gaagtgccgtctgaagacccgatttccaaaatccaactgaccccttcgcaaaaagcattg
ggcaaatacgtcttcctgacggtcgccctgtttgtggtacaagtattgctgggcggactg
accgcgcactacaccgtcgaaggccagggtttctacggcattgacgaggcgttgggcttt
gaaatgtccgactggttcccctacgccctgacccgtacttggcacatccaatccgccatc
ttctggattgcaaccggctttttgacggcaggtttgttcctcgcgccgattgtcaacggc
ggtaaagatcccaagttccaacgtgccggcgtaaacttcctctatatcgccctcttcatc
gtggtcggcggttcttacgcgggcaacttcttcgcgttgacgcacatccttcccccggaa
tttaacttctggttcggacaccaaggttacgaatacctcgatttgggacgtttctggcaa
ctccttttgatggtcggtctgctgttatggctgttcctgatgttgcgttgcacggtttcc
gcctttaaagaaaaaggcgtggacaaaaacctgttggctatcttcgtagcttctatggtc
ggtgtgggcgtattctacgcaccaggcctgttctatggcgaaaaatccccgattgccgtt
atggaatactggcgttggtgggtggttcacctgtgggtagaaggcttcttcgaagtattt
gccactgccgcctttgcctttgtcttctacaatatgggctttgtccgccgcagtaccgcc
actgcctccactttggccgctgccgccatctttatgttgggcggcgttccgggcacgctg
caccacctgtacttctccggctctacctccgcctctatggcaatcggtgcctgcttctcc
gctttggaagtcgtgccgctggtgttgctgggccgtgaagcatacgaacactggtcttac
caacacctgtccgactgggcgaaacgcctgcgttggccgctgatgtgcttcgtggcagtc
gccttttggaatatgatcggtgccggcgtattcggcttcctgatcaatccgccgatttcc
ctgttctatatccaaggtttgaacacttctgccgttcacgcgcacgccgccttgtttggt
gtgtacggtttcttggcattgggcttcgtattgctggttgcccgttatttgaaaccgaac
gcgcagtttgacgacaaactgatgacttggggcttctggctgctcaacggcggcttggcc
ggtatgattgccatcagcctgctgcctgtcggcgcgattcaggcatacgcctccatcacg
cacggtctgtggtatgcccgcagcgaagagttcctgcaaatggaaatcctcgataccttg
cgttgggtacgtacggcagctgacttggtctttatcggcggtgcaatctgtgtcgccatc
caagccactaaaatcgtattcggccgcgacaaataa

DBGET integrated database retrieval system