KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1623Help
Entry
NMB1623           CDS       T00027                                 

Gene name
pan1
Definition
(RefSeq) major anaerobically induced outer membrane protein
  KO
K00368  
nitrite reductase (NO-forming) [EC:1.7.2.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    NMB1623 (pan1)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.1  nitrite reductase (NO-forming)
     NMB1623 (pan1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1687956..1689128
Genome map
AA seq 390 aa AA seqDB search
MKRQALAAMIASLFALAACGGEPAAQAPAETPAAAAEAASSAAQTAAETPSGELPVIDAV
TTHAPEVPPAIDRDYPAKVRVKMETVEKTMTMEDGVEYRYWTFDGDVPGRMIRVREGDTV
EVEFSNNPSSTVPHNVDFHAATGQGGGAAATFTAPGRTSTFSFKALQPGLYIYHCAVAPV
GMHIANGMYGLILVEPKEGLPKVDKEFYIVQGDFYTKGKKGAQGLQPFDMDKAVAEQPEY
VVFNGHVGAIAGDNALKAKAGETVRMYVGNGGPNLVSSFHVIGEIFDKVYVEGGKLINEN
VQSTIVPAGGSAIVEFKVDIPGSYTLVDHSIFRAFNKGALGQLKVEGAENPEIMTQKLSD
TAYAGNGAAPAASAPAASAPAASASEKSVY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgccaagccttagctgcaatgattgcttccttattcgcattagccgcctgcggc
ggcgaacctgccgcgcaagcccctgccgaaacccctgccgctgccgccgaagccgcaagc
tccgccgcacaaaccgccgccgaaacaccgtccggcgaactgcccgttatcgatgcggtt
accacccacgctcccgaagtgcctcctgcaatcgaccgcgactaccccgccaaagtccgc
gtaaaaatggaaaccgtcgaaaaaaccatgaccatggaagacggtgtggaataccgctac
tggacatttgacggcgacgttccgggccgtatgatccgcgtacgcgaaggcgatacggtt
gaagtggaattttccaacaatccttcttctaccgttccgcacaacgtcgacttccacgcg
gctaccggccagggcggcggcgcggccgcaacctttaccgctccgggccgtacttccaca
ttcagcttcaaagccctgcaaccgggtctgtacatctaccactgcgccgtcgcaccggtc
ggtatgcacatcgccaacggtatgtacggtctgattttggtcgagcctaaagaaggcctg
ccgaaagtggataaagagttctacatcgtccaaggcgacttctacaccaaaggcaaaaaa
ggcgcgcaaggtctgcaaccgttcgatatggacaaagccgttgccgaacagcctgaatac
gtcgtattcaacggtcacgtaggtgctatcgccggcgataacgcgctgaaagccaaagca
ggcgaaactgtacgtatgtacgttggtaacggcggtccgaacttggtatcttccttccac
gtcatcggcgaaatcttcgacaaagtttatgttgaaggcggcaaactgattaacgaaaac
gtacaaagcaccatcgttcctgccggcggctctgccatcgtcgaattcaaagtcgacatc
ccgggcagctacactttggttgaccactctatcttccgcgcattcaacaaaggcgcactg
ggtcaattgaaagtagaaggtgcagaaaaccctgaaatcatgactcaaaaattgagtgat
accgcttacgccggtaacggtgcagctcctgctgcttccgctcccgcagcttctgccccg
gcagcctctgcatccgaaaaaagcgtttattaa

DBGET integrated database retrieval system