KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1638Help
Entry
NMB1638           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K03760  
lipid A ethanolaminephosphotransferase [EC:2.7.8.43]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    NMB1638
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.43  lipid A phosphoethanolamine transferase
     NMB1638
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Lipid A
  NMB1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1701922..1703556)
Genome map
AA seq 544 aa AA seqDB search
MIKPNLRPKLGSSALIAFLSLYSSLVLNYAFFAKVVELHPFNGTGADIFLYTMPVVLFFL
SNFVFHVIALPFVHKVLIPLILVISAAVSYQEIFFNIYFNKSMLNNVLQTTAAESARLIT
PGYVLWIVCLGVLPALAYIAVKVKYRVWYKELLTRLVLAAVSFLCALGIAMLQYQDYASF
FRNNKSVTHLIVPSNFIGAGVSKYKDWKRSNIPYTQLDMAVVQNRPAGSLRRFVVLVVGE
TTRAANWGLNGYSRQTTPLLAARGDEIVNFPQVRSCGTSTAHSLPCMFSTFDRTDYDEIK
AEHQDNLLDIVQRAGVEVTWLENDSGCKGVCGKVPNTDVTSLNLPEYCRNGECLDNILLT
KFDEVLNKNDKDAVLILHTIGSHGPTYYERYTEAERKFTPTCDTNEINKCTRATLVNTYD
NTVLYVDQFIDKVIRKLENRDDLESVVHYVSDHGESLGENGMYLHAAPYAIAPSGQTHIP
MVMWFSKAFRQHGGIDFQCLKQKAAENEYSHDHYFSTVLGLMDISNSQTYRKEMDILAAC
RRPR
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaccgaacctgaggccgaagctcggctcttccgcgctgattgccttcctttcc
ctgtattcctcgctggtattgaattacgccttttttgccaaagttgtcgagcttcatcct
tttaacggcaccggggcggatatcttcctctatacgatgccggtggtgctgtttttttta
agtaatttcgtttttcacgtcattgccctgcctttcgtgcataaggtattgattccgttg
atattggttatcagtgcggcggtgtcttaccaagaaatatttttcaatatctatttcaac
aagtcgatgttgaataatgtcttgcaaactacggctgccgaaagcgcgcgcctgattacg
ccgggctatgtgctgtggattgtatgtttgggcgtattgcccgcgctggcgtatatcgcc
gtcaaggttaaataccgcgtttggtataaggagcttttgacgcgccttgtgcttgccgcc
gtttcctttttgtgcgcgttgggcatcgcaatgttgcaatatcaggattacgcctcgttt
ttccgcaacaataaatcagtaacccatctgattgtgccgtctaatttcatcggcgcgggc
gtgtcgaaatacaaagattggaagcgttccaatattccttatacgcaattggatatggcg
gtcgtgcaaaaccgcccggccggcagcctgcgccgtttcgtggtgctggtcgtgggcgag
accacgcgtgccgccaactggggtttgaacggttacagccgccaaactacgccgctgctt
gccgcgcgcggcgatgaaattgtcaatttcccgcaggtcagaagctgcggcacatcgacc
gcgcactccctgccgtgtatgttctcaaccttcgaccgcacggattatgacgaaatcaaa
gccgaacaccaagacaacctgctggacatcgtgcagcgcgccggcgtggaagttacttgg
ttggaaaacgattccggctgcaagggcgtgtgcggcaaagtgccgaataccgacgttacc
tcgctcaacctgcccgaatactgccgcaacggcgagtgcctcgacaatatcctgctgact
aagttcgacgaagtcctcaacaaaaacgataaagacgcggttttaatcctgcataccatc
ggcagccacgggccgacgtattacgaacgctataccgaagccgaacgcaaattcacgccg
acctgcgacaccaacgaaatcaacaaatgcacccgcgccacgctggtcaacacttacgac
aatacggttttgtatgtggaccagtttatcgacaaggttatccgcaaacttgaaaaccgc
gacgatttggaaagcgtggtgcattatgtttccgaccacggcgaaagtttgggcgaaaac
gggatgtacctgcacgccgcgccttacgccatcgcgccttccgggcagacgcatatcccg
atggttatgtggttttccaaagccttccgccaacacgggggcatagatttccaatgcctc
aaacaaaaagcggcggaaaacgaatattcgcacgaccactatttcagcacggtattgggg
ctgatggacatttccaatagccaaacctatcggaaggaaatggatatattggcagcctgc
cgccgtccgcgctga

DBGET integrated database retrieval system