KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1658Help
Entry
NMB1658           CDS       T00027                                 

Gene name
coaBC
Definition
(RefSeq) phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
  KO
K13038  
phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB1658 (coaBC)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     NMB1658 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     NMB1658 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1731103..1732287
Genome map
AA seq 394 aa AA seqDB search
MGKHILLGVTGSIAAYKSCELVRLLKKQGHSVTVVMSRSATEFVSPLTFQALSGNPVLTD
THGGNGSNGMEHINLTRNADVFLIAPASMNTVAKICNGVADNLLTSLAAARKCPLAIAPA
MNVEMWLNPANQRNIAQLVSDGITVYMPGLGEQACGENGMGRMPEPAELLDLLPDLWTPK
ILKGKKVLITAGATFEAIDPVRGITNISSGKMGVALARACRAAGAEVSLIHGQLQTALPF
GISDTVQAVSAENMHRAVHRLIDKQDAFISVAAVSDYRVKNRSTQKFKKDKNAKPLSIEL
DENPDILASIASLPNPPFCIGFAAETENVMTYAREKRIKKKLPMIVANDVSIAMGKPTNR
ITIIGDDGELSFPETSKDEAAMRIVERLAVYLSK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaacatattcttttaggtgtaacgggcagtattgcggcgtataagtcttgcgag
ttggtgcgactgctgaaaaaacaggggcattcggttacggtggttatgagccgctcggca
actgaatttgtttctccgctgacttttcaggctttaagcggcaatcctgtcctgaccgac
acgcacggcggcaacggttcaaacggtatggaacatatcaacctgacccggaatgcggat
gtttttctgattgcgccggcaagtatgaataccgtggcaaaaatctgtaacggcgtggca
gataacctactgaccagtctggcagccgcacggaaatgtccgcttgccatcgcgcccgcg
atgaatgtggaaatgtggctcaaccctgccaaccaacggaatatcgcacaactggtttca
gacggcattactgtctatatgccgggcttgggcgaacaggcttgcggagaaaatggtatg
ggaaggatgccggaacctgccgaattgctggatctgcttccggatttatggacaccgaaa
attttaaagggcaaaaaagtcttgattaccgcaggtgcgacatttgaagccattgaccct
gtccgaggcatcacaaatatctccagcgggaaaatgggcgtggctttggcgcgggcgtgc
cgtgccgccggtgcagaagtcagcctgattcacggacagcttcaaaccgcgctgcctttc
ggcatatccgatacggttcaagccgtcagtgccgaaaatatgcatcgcgcagtgcatcgt
ttaatcgacaaacaagatgcttttatttctgttgccgccgtctcagactatagggttaag
aataggagtactcaaaaattcaaaaaagataaaaatgccaaaccgttatccatcgaattg
gatgagaaccccgatattttggcttctattgcctcattaccgaacccgccgttctgcatc
ggttttgccgctgaaacggagaatgtaatgacatatgcgcgggaaaaacgtattaagaaa
aagctaccgatgatcgttgccaatgatgtttcaatcgcaatgggcaaaccgaccaaccgg
attaccattatcggggacgacggggaactgtcttttcccgaaacaagtaaagatgaagcg
gcaatgcggattgttgaaaggcttgccgtatatttgagcaaataa

DBGET integrated database retrieval system