KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1659Help
Entry
NMB1659           CDS       T00027                                 

Gene name
spoT
Definition
(RefSeq) guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase
  KO
K01139  
GTP diphosphokinase / guanosine-3',5'-bis(diphosphate) 3'-diphosphatase [EC:2.7.6.5 3.1.7.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB1659 (spoT)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     NMB1659 (spoT)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.7  Diphosphoric-monoester hydrolases
    3.1.7.2  guanosine-3',5'-bis(diphosphate) 3'-diphosphatase
     NMB1659 (spoT)
Ribosome biogenesis [BR:nme03009]
 Prokaryotic Type
  Other maturation factors
   NMB1659 (spoT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1732354..1734510)
Genome map
AA seq 718 aa AA seqDB search
MPAPQPSAPYDPLTAEARALLFHTASYLKPEEQAELEKAVAYAFRAHDGQTRKSGEPYIT
HPIAVATQLALWHMDIQGLCAGVMHDVLEDTGVTKGEMAAVFGNTIAEMVDGLSKLEKLK
FEDHAEHQAESFRKLILAMTKDVRVIVVKLADRLHNMRTLGSMRPDKRRRIARETLEIYA
QIANRIGLNNAYQELQDLSFQNLHPNRYETLKKAMDKSRKNRQDVVGKVLRAFGQRLVGA
NIEAKIKGREKNLYGIHQKMMAKKLRFAEVMDIYGFRVIVNSIPACYAALGALHTLYQPK
PGRFKDYIAIPKSNGYQSLHTTLVGPYGLPIEVQIRTKEMDAVAEGGIAGHWSYKSYSKT
VDQAVLHTNRWLKNILDLQASSANAIEFLEHVKVDLFPNEIYILTPKGKILTLPKGATPV
DFAYAVHTDIGHKTVAARINNIMMPLRTKLKTGDSVEIITSEHAKPNPAWLNFAVSGRAR
SAIRQYIKNLNRHDAVVLGESLLQKALSSLLPKDVLLSDGIKEKYLADLNDKQTSFEEVL
YNVGMGHTLPVYVAMHIAELAGEHFGSEVRLSSIKVDGQESGHIHFAECCHPVPGDSIRL
LLVKGKGMIIHRDTCPTLLKSDPEQQLDADWENMNGQNYRVGLQVQSEDSHGLLALMAQA
ISDSGADIESVETPSKSQSGTEGFVEFKFLLKVKNLNQLNQIIQNLHSIPYIRKVIRS
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccccccaaccttccgccccttacgaccccctgaccgccgaagcgcgtgccctg
cttttccataccgcctcctacctcaagcccgaggaacaggcggagcttgaaaaagctgtc
gcctatgcgtttcgcgcccacgacgggcaaacccgcaaaagcggggagccctacatcacg
catccgattgccgttgcgacgcagctcgccctttggcatatggacatacagggtctttgt
gcaggcgtgatgcacgacgtattggaagatacgggcgtgacaaaaggggaaatggcggcg
gtgttcggcaatacgattgccgagatggtggacggtctgtccaagcttgaaaaactcaaa
tttgaagatcatgcggagcatcaggcggagagtttccgcaaactgattttggcaatgacc
aaagatgtgcgcgtgattgtcgtcaaacttgccgaccgcctgcacaatatgcggacgctc
ggttcgatgcgcccggacaaacgccgccggattgcaagggaaacccttgaaatctatgca
cagattgccaaccgtataggtttgaataacgcatatcaagagcttcaggatttatcgttc
caaaacctgcatcccaaccgctacgagactttaaaaaaagcgatggacaagagccggaag
aaccggcaggacgttgtcggcaaagtcttgcgcgcattcggccagcggctggtaggcgcg
aatatagaggccaaaatcaaaggcagggaaaaaaacctgtacggcatccatcagaaaatg
atggcgaaaaagctgcgctttgccgaggttatggatatttacggtttccgcgtcattgtc
aacagcattccagcctgttatgccgcactcggcgcattgcacaccctctatcagcccaag
cccgggcggttcaaagactatatcgccattccgaaaagcaacgggtatcaaagtctgcat
acgactttggtcggcccttacggcttgccgattgaagttcagatacgtaccaaggaaatg
gatgctgttgccgaaggtggaatcgccggacattggagctataaatcatattctaagacg
gtcgatcaggcggtgcttcacacaaaccggtggctgaaaaatatcttagatttgcaggca
agcagtgccaatgccattgagtttctcgaacacgtcaaagtcgatttgtttccgaacgaa
atctacatccttacgccaaaaggaaaaatcctaactttgcccaaaggggcaacgcctgtc
gattttgcttatgcggtgcataccgatatcgggcacaaaaccgttgccgcacgtatcaac
aatatcatgatgccgttgcgtacgaagctcaaaaccggtgattctgttgaaattatcaca
tccgaacacgccaaacccaatcccgcgtggttgaatttcgccgtgtcaggcagggcgcgc
agcgccatacgccaatatattaaaaaccttaaccggcacgatgcggtcgttttgggagag
agcctcttacaaaaagccctgtccagtttgctgcccaaagatgtcctgctttcagacggc
atcaaggaaaaatatcttgccgatctcaacgacaagcagacatcgtttgaagaagtgctg
tacaacgtagggatggggcataccctgcctgtttatgtcgccatgcacattgccgagttg
gcaggggagcatttcggcagcgaggtcaggctcagttccattaaagtcgatgggcaggaa
agcgggcatattcattttgcagagtgctgccaccctgttcccggcgattccatccgtttg
ctgttggttaagggaaaaggcatgattatccatagggatacctgcccgacgttgttgaag
tccgatcccgaacagcagctggatgcagactgggaaaatatgaacgggcagaactaccgt
gtcgggcttcaagtccaatcggaagacagccacggcctgttggcattaatggcgcaagcg
atttccgattccggtgcagacattgagtcggtcgaaacaccgtctaaatcccagtcggga
acggaaggttttgtcgaattcaaattcttattgaaagtcaagaatctgaatcaattgaat
cagattattcaaaatctgcatagtattccatatatccgcaaagtcatcagaagttga

DBGET integrated database retrieval system