KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1662Help
Entry
NMB1662           CDS       T00027                                 

Gene name
apt
Definition
(RefSeq) adenine phosphoribosyltransferase
  KO
K00759  
adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB1662 (apt)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     NMB1662 (apt)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMB1662 (apt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1735645..1736211
Genome map
AA seq 188 aa AA seqDB search
MLVHPEAMSVGALADKIRKIENWPQKGILFHDITPVLQSAEYFRLLVDLLVYRYMDQKID
IVAGLDARGFIIGAALAYQLNVGFVPIRKKGKLPFETVSQSYALEYGEAAVEIHTDAVKL
GSRVLLVDDLIATGGTMLAGLELIRKLGGEIVEAAAILEFTDLQGGKNIRASGAPLFTLL
QNEGCMKG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgctggttcatcccgaagctatgagtgtcggcgcgcttgccgacaaaatccgcaaaatc
gaaaactggccgcaaaaaggcatcttattccacgacatcacgcccgtccttcaaagcgcg
gaatacttccgccttttggttgatttattggtttaccgctatatggatcagaaaatcgac
atcgttgccggtttggacgcgcgcggcttcattatcggcgcggcactcgcctaccagctc
aacgtcggtttcgtccccatccgcaaaaaaggcaagctgccttttgaaaccgtatcgcaa
agctacgcgctcgaatacggggaagctgcggtggaaatccacaccgatgccgtcaaactc
ggttcgcgcgtgctgctggtcgatgatttgattgccacgggcggcacgatgcttgccgga
ctggaactgatccgcaaactcggcggagaaattgtcgaagccgccgccattttggaattt
accgaccttcaaggcggcaagaatatccgtgcaagcggcgcgcccttatttaccctgctt
caaaacgaaggctgtatgaagggctga

DBGET integrated database retrieval system