KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1663Help
Entry
NMB1663           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 Hydrolase S6PP HAD Acid_PPase Hydrolase_6 Glyco_hydro_129
Motif
Other DBs
NCBI-GeneID: 903447
NCBI-ProteinID: NP_274668
UniProt: Q9JYB3
Position
complement(1736257..1737045)
Genome map
AA seq 262 aa AA seqDB search
MNPKIVFFDIDDTLYRKYTDTLRPSVKTAVAALRGKGILTALATGRSLATIPEKVRDMMA
EAGMDAVVTINGQFALLHGKTVREVPMDAGLMGRVCAHLDGLGMDYAFVGGEGIAVSALS
ECVCRALKHIASDFFADKDYFSSKPVYQMLVFAEENEMPLWSDIVEREGLKTVRWHEEAV
DLLPAGASKTDGIRSVVEALGWEMADVMAFGDGLNDVEMLSEVGFGVAMGNGEQAAKEAA
KYVCPSVDEDGVLRGLQDLGVI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctaaaatcgtgtttttcgacattgacgatacgctgtaccgaaaatatacggat
actttgcgcccttccgtgaaaacggcggtggcggctttgcgcggcaaaggtatattgacg
gcgttggcaacggggcggtctttggcgacgattcccgaaaaggtcagggatatgatggcg
gaagcgggaatggatgccgtggtaacgataaacggacagtttgcgctgctgcacggaaaa
accgtgcgcgaagtaccgatggatgccggtttgatgggcagggtttgcgcgcatttggat
ggcttgggcatggattatgcgtttgtcggcggagaggggatcgctgtgtccgcgctgtcg
gaatgcgtgtgccgcgccttgaagcatatcgccagcgatttttttgccgataaggattat
ttttcaagcaaaccggtgtatcagatgctggtgtttgcggaggaaaacgaaatgccgctt
tggtcggatattgtggaacgggaaggcttgaaaacggtgcgctggcacgaggaagcggtc
gatctgctgcctgcgggtgcgtcgaaaacggacggcatcagaagcgtggttgaagcattg
ggatgggaaatggcagacgtgatggcgttcggcgacggtttgaacgatgtggaaatgctg
tcagaagtcgggttcggcgtggcaatgggcaacggggaacaggcggcgaaagaagcggcg
aaatatgtttgccccagcgttgatgaagacggcgtgttgaggggcttgcaagatttgggc
gtgatttga

DBGET integrated database retrieval system