KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1668Help
Entry
NMB1668           CDS       T00027                                 

Gene name
hmbR
Definition
(RefSeq) hemoglobin receptor
  KO
K16087  
hemoglobin/transferrin/lactoferrin receptor protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Transporters [BR:nme02000]
 Other Transporters
  Pores ion channels [TC:1]
   NMB1668 (hmbR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1740259..1742634)
Genome map
AA seq 791 aa AA seqDB search
MKPLQMLPIAALVGSIFGNPVLAADEAATETTPVKAEIKAVRVKGQRNAPAAVERVNLNR
IKQEMIRDNKDLVRYSTDVGLSDSGRHQKGFAVRGVEGNRVGVSIDGVNLPDSEENSLYA
RYGNFNSSRLSIDPELVRNIEIVKGADSFNTGSGALGGGVNYQTLQGRDLLLDDRQFGVM
MKNGYSTRNREWTNTLGFGVSNDRVDAALLYSQRRGHETESAGNRGYAVEGEGSGANIRG
SARGIPDSSKHKYHSFLGKIAYQINDNHRIGASLNGQQGHNYTVEESYNLTASSWREADD
VNRRRNANLFYEWMPDSNWLSSLKADFDYQKTKVAAVNNKGSFPMDYSTWTRNYNQKDLD
EIYNRSMDTRFKRFTLRLDSHPLQLGGGRHRLSFKTFVSRRDFENLNRDDYYFSGRVVRT
TSSIQHPVKTTNYGFSLSDQIQWNDVFSSRAGIRYDHTKMTPQELNAECHACDKTPPAAN
TYKGWSGFVGLAAQLNQAWRVGYDITSGYRVPNASEVYFTYNHGSGNWLPNPNLKAERST
THTLSLQGRSEKGMLDANLYQSNYRNFLSEEQKLTTSGTPGCTEENAYYGICSDPYKEKL
DWQMKNIDKARIRGIELTGRLNVDKVASFVPEGWKLFGSLGYAKSKLSGDNSLLSTQPLK
VIAGIDYESPSEKWGVFSRLTYLGAKKVKDAQYTVYENKGWGTPLQKKVKDYPWLNKSAY
VFDMYGFYKPAKNLTLRAGVYNLFNRKYTTWDSLRGLYSYSTTNAVDRDGKGLDRYRAPG
RNYAVSLEWKF
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccattacaaatgctccctatcgccgcgctggtcggcagtattttcggcaatccg
gtcttggcagcagatgaagctgcaactgaaaccacacccgttaaggcagagataaaagca
gtgcgcgttaaaggtcagcgcaatgcgcctgcggctgtggaacgcgtcaaccttaaccgt
atcaaacaagaaatgatacgcgacaataaagacttggtgcgctattccaccgatgtcggc
ttgagcgacagcggccgccatcaaaaaggctttgctgttcgcggcgtggaaggcaaccgt
gtcggcgtgagcatagacggtgtaaacctgcctgattctgaagaaaactcgctgtacgcc
cgttatggcaacttcaacagctcgcgtttgtctatcgaccccgaactcgtgcgcaacatc
gaaatcgtgaagggcgcagactctttcaataccggcagtggtgcattgggcggcggtgtg
aattaccaaacgctgcaaggccgtgatttgctgttggacgacaggcaattcggcgtgatg
atgaaaaacggttacagcacgcgtaaccgtgaatggacaaatactctcggtttcggtgtg
agtaacgaccgcgtggatgctgctttgctgtattcgcaacgtcgcggtcatgaaaccgaa
agtgcgggaaaccgaggctatgctgtggaaggggaaggcagtggcgcgaatatccgtggt
tcggcacgcggtatccctgattcgtccaaacacaaataccacagctttttgggtaagatt
gcttaccaaattaacgataaccaccgcatcggcgcatcgcttaacggccagcagggacat
aattacacggttgaagagtcttataacctgaccgcttcttcctggcgcgaagccgatgac
gtaaacagacggcgcaatgccaacctcttttacgaatggatgcctgattcaaattggttg
tcgtctttgaaggcggacttcgattatcagaaaaccaaagtggcggcggttaacaacaaa
ggctcgttcccgatggattattccacctggacgcgcaactataatcagaaggatttggac
gaaatatacaaccgcagcatggacacccgattcaaacgttttactttgcgtttggacagc
catccgttgcaactcgggggggggcgacaccgcctgtcgtttaaaactttcgtcagccgc
cgtgattttgaaaacctaaaccgcgacgattattacttcagcggccgtgttgttcgaacc
accagcagtatccagcatccggtgaaaaccaccaactacggtttctcactgtctgaccaa
attcaatggaacgacgtgttcagtagccgcgcaggtatccgttacgaccacaccaaaatg
acgcctcaggaattgaatgccgagtgtcatgcttgtgacaaaacaccacctgcagccaac
acttataaaggctggagcggttttgtcggcttggcggcgcaactgaatcaggcttggcgt
gtcggttacgacattacttccggctaccgtgtccccaatgcgtccgaagtgtatttcact
tacaaccacggttcgggtaattggctgcccaatcccaacctgaaagccgagcgcagcacc
acccacaccctgtctctgcaaggccgcagcgaaaaaggcatgctggatgccaacctgtat
caaagcaattaccgcaatttcctgtctgaagagcagaagctgaccaccagcggcactccc
ggctgtactgaggaaaatgcttactacggtatatgcagcgacccctacaaagaaaaactg
gattggcagatgaaaaatatcgacaaggccagaatccgcggtatcgagctgacaggccgt
ctgaatgtggacaaagtagcgtcttttgttcctgagggttggaaactgttcggctcgctg
ggttatgcgaaaagcaaactgtcgggcgacaacagcctgctgtccacacagccgctgaaa
gtgattgccggtatcgactatgaaagtccgagcgaaaaatggggcgtattctcccgcctg
acctatctaggcgcgaaaaaggtcaaagacgcgcaatacaccgtttatgaaaacaagggc
tggggtacgcctttgcagaaaaaggtaaaagattacccgtggctgaacaagtcggcttat
gtgtttgatatgtacggcttctacaaaccggctaaaaacctgactttgcgtgcaggcgtg
tacaacctgttcaaccgcaaatacaccacttgggattccctgcgcggtttatatagctac
agcaccaccaatgcggtcgaccgcgatggcaaaggcttagaccgctaccgcgccccaggc
cgcaattacgccgtatcgctggaatggaagttttaa

DBGET integrated database retrieval system