KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1669Help
Entry
NMB1669           CDS       T00027                                 

Definition
(RefSeq) heme utilisation protein
  KO
K07215  
heme oxygenase
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1742829..1743458)
Genome map
AA seq 209 aa AA seqDB search
MSETENQALTFAKRLKADTTAVHDSVDNLVMSVQPFVSKENYIKFLKLQSVFHKAVDHIY
KDAELNKAIPELEYMARYDAVTQDLADLGDKPYEYGKPLPHETGNKAIGWLYCAEGSNLG
AAFLFKHAQKLDYNGEHGARHLAPHPDGRGKHWRAFVEHLNALNLTPEAEAEAIQGAREA
FAFYKVVLRETFGLAADAEAPEGMMPHRH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaccgaaaatcaagcattgacatttgccaaacgcttgaaggcggataccacg
gcggttcacgacagcgtggataacctcgttatgtctgtccaaccgtttgtcagcaaagaa
aactacatcaaatttttgaaactccaatccgttttccacaaggctgtcgaccacatctat
aaagatgccgaattaaacaaagccattcccgagctggaatacatggcgcgatacgatgcc
gtaacgcaagaccttgcagatttgggtgacaaaccttacgaatacggcaaaccgctgccg
catgaaaccggcaacaaagcaatcggctggctttattgcgccgaaggatccaatttgggc
gcggcatttttgttcaaacacgcccaaaaactcgattacaacggcgaacacggcgcgcgc
cacctcgcaccccatcccgacgggcgcggcaaacactggcgcgctttcgtcgagcatctg
aacgctttgaacctgactcccgaagccgaagcggaagccatccaaggcgcgcgcgaagcc
tttgcattctacaaagtcgtgttgcgcgaaaccttcggcttggcagccgatgccgaagca
ccggaaggaatgatgccgcacaggcactaa

DBGET integrated database retrieval system