KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1669Help
Entry
NMB1669           CDS       T00027                                 

Definition
(RefSeq) heme utilisation protein
  KO
K07215  
heme oxygenase (biliverdin-IX-beta and delta-forming) [EC:1.14.99.58]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMB1669
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.58  heme oxygenase (biliverdin-IX-beta and delta-forming)
     NMB1669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1742829..1743458)
Genome map
AA seq 209 aa AA seqDB search
MSETENQALTFAKRLKADTTAVHDSVDNLVMSVQPFVSKENYIKFLKLQSVFHKAVDHIY
KDAELNKAIPELEYMARYDAVTQDLADLGDKPYEYGKPLPHETGNKAIGWLYCAEGSNLG
AAFLFKHAQKLDYNGEHGARHLAPHPDGRGKHWRAFVEHLNALNLTPEAEAEAIQGAREA
FAFYKVVLRETFGLAADAEAPEGMMPHRH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaccgaaaatcaagcattgacatttgccaaacgcttgaaggcggataccacg
gcggttcacgacagcgtggataacctcgttatgtctgtccaaccgtttgtcagcaaagaa
aactacatcaaatttttgaaactccaatccgttttccacaaggctgtcgaccacatctat
aaagatgccgaattaaacaaagccattcccgagctggaatacatggcgcgatacgatgcc
gtaacgcaagaccttgcagatttgggtgacaaaccttacgaatacggcaaaccgctgccg
catgaaaccggcaacaaagcaatcggctggctttattgcgccgaaggatccaatttgggc
gcggcatttttgttcaaacacgcccaaaaactcgattacaacggcgaacacggcgcgcgc
cacctcgcaccccatcccgacgggcgcggcaaacactggcgcgctttcgtcgagcatctg
aacgctttgaacctgactcccgaagccgaagcggaagccatccaaggcgcgcgcgaagcc
tttgcattctacaaagtcgtgttgcgcgaaaccttcggcttggcagccgatgccgaagca
ccggaaggaatgatgccgcacaggcactaa

DBGET integrated database retrieval system