KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1680Help
Entry
NMB1680           CDS       T00027                                 

Gene name
aroC
Definition
(RefSeq) chorismate synthase
  KO
K01736  
chorismate synthase [EC:4.2.3.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB1680 (aroC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB1680 (aroC)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     NMB1680 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1756200..1757300
Genome map
AA seq 366 aa AA seqDB search
MAGNTFGQLFTVTTFGESHGAGLGCIIDGCPPGLELSEADIQFDLDRRKPGTSRHVTQRR
EADQVEILSGVFEGKTTGTPIALLIRNTDQRSKDYGNIATSFRPGHADYTYWHKYGTRDY
RGGGRSSARETAARVAAGAVAKKWLKEKFGTEITAYVTQVGEKEIRFEGCEHISQNPFFA
ANHSQIAELENYMDSVRKSLDSVGAKLHIEAANVPVGLGEPVFDRLDAEIAYAMMGINAV
KGVEIGAGFDSVTQRGSEHGDELTPQGFLSNHSGGILGGISTGQDIRVNIAIKPTSSIAT
PRRSIDINGNPIELATHGRHDPCVGLRSAPIAEAMLALVLIDHALRHRAQNADVQVNTPD
ITLSNK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaacactttcggacaactcttcaccgttaccaccttcggcgaaagccacggc
gcgggtttgggctgtatcatcgacggctgcccgcccggcttggaattaagcgaagcggat
atccaatttgacctcgaccgacgcaaacccggcaccagccgccacgttacccaacgccgc
gaagccgaccaagtcgaaatcctctccggcgtattcgaaggcaaaaccaccggcacgccc
atcgccctcttaatccgcaataccgaccagcgcagcaaagactacggcaacatcgccacc
agcttccgccccggccacgccgactatacctattggcacaaatacggcacgcgcgactac
cgcggcggcggcaggagctccgcccgtgaaaccgccgcccgcgttgctgccggagccgtt
gccaaaaaatggttgaaagaaaaattcggcacggaaatcaccgcctacgttacccaagtc
ggcgaaaaagaaatccggtttgaaggctgcgaacacatttcccaaaatcctttttttgcc
gccaaccatagccaaattgccgagctggaaaactatatggacagcgtgcgcaaatccttg
gattccgtcggcgcgaagctgcatatcgaagcagccaatgtccctgtcggcttgggcgaa
cctgtttttgaccgcctcgatgccgaaatcgcctacgcgatgatgggcatcaacgccgtc
aaaggcgtggaaatcggcgcaggttttgacagcgtaacgcaacgcggcagcgaacacggc
gacgaactgaccccgcaaggcttcctgtccaaccactcaggcggcatcctcggcggcatc
agcaccgggcaagacatccgcgtcaatatcgccatcaaacccaccagctccatcgccacc
ccgcgccgcagtatcgacatcaacggcaaccccatcgaactcgccacgcacggcaggcac
gacccctgcgtcggactgcgctccgcgccgatcgccgaagccatgctcgcgttagtcctc
atcgaccacgccctgcgccatcgcgcgcaaaatgccgacgttcaggttaatacgcccgac
attaccctttcaaacaaataa

DBGET integrated database retrieval system