KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1685Help
Entry
NMB1685           CDS       T00027                                 

Gene name
ldhA
Definition
(RefSeq) D-lactate dehydrogenase
  KO
K03778  
D-lactate dehydrogenase [EC:1.1.1.28]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyruvate metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB1685 (ldhA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.28  D-lactate dehydrogenase
     NMB1685 (ldhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1762006..1763004)
Genome map
AA seq 332 aa AA seqDB search
MKIAIYGTKSYDREHFTRANRHFGFELEFFDFMLDAKTAKMAEGAEAVCIFVNDDGSRPV
LEKLAQIGVKTVALRCAGFNNVDLKAAEELGLKVVRVPAYSPESVAEHTVGLMLTLNRRI
HKAYQRTRDANFSLEGLTGFNMYGKTAGVIGTGKIGIATMRILKGFGMNLLAYDPFCNPE
AEKIGGKYVDLDELYARSDIITLHCPATPENHYMLNEAAFDKMKDGVMIINTSRGGLIDS
AAAIEALKRRKIGALGMDVYENERELFFEDKSNDVITDDVFRRLSSCHNVLFTGHQAFLT
EEALGNISEVTLSNIREVGQTGDCGNAVRADG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcgatttacggtacgaaaagctatgaccgcgaacattttacccgcgccaac
cggcatttcggcttcgagctggagttttttgattttatgctggatgcgaaaacggcgaaa
atggcggaaggcgcggaagcggtctgtatttttgtaaacgacgacggcagccggcccgtg
ttggaaaaattggcgcaaattggcgtgaaaactgtggcgttgcgttgtgccggcttcaat
aatgtggatttaaaggcggctgaagagttgggcttgaaagtcgtgcgcgtgcctgcctat
tcgcccgaatcggttgcggaacatacggtcggtctgatgctgacgttgaaccgccgtatc
cacaaagcctatcagcgtacccgcgatgcgaatttttcgctggaaggtctgaccggtttc
aatatgtacggcaaaacggcgggcgttatcggcacggggaaaatcggtattgcaaccatg
cggattttaaagggtttcggcatgaacctgctggcttacgatccgttttgcaaccccgaa
gcggaaaaaatcggcggcaaatatgtggatttagacgagctgtatgcccggtcggacatc
atcacgctgcattgccccgccacgccggaaaaccactatatgctgaacgaagcggcgttc
gacaaaatgaaagacggcgtgatgattatcaacaccagccggggcgggctgattgacagt
gccgccgcgattgaggcgttgaaacgccggaaaatcggcgcattgggcatggatgtgtac
gagaacgagcgcgagctgttttttgaagacaaatccaacgatgtgattaccgacgacgtg
ttccgccgcctgtcgtcttgtcataatgtgctgtttaccggccatcaggcatttttgacg
gaagaggcgttgggtaatatttcggaagttacgctgtccaatatccgcgaggtcggacag
accggcgattgcggcaatgcggttcgtgccgacggctga

DBGET integrated database retrieval system