KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1688Help
Entry
NMB1688           CDS       T00027                                 

Gene name
ansA
Definition
(RefSeq) L-asparaginase
  KO
K01424  
L-asparaginase [EC:3.5.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Alanine, aspartate and glutamate metabolism
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB1688 (ansA)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    NMB1688 (ansA)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     NMB1688 (ansA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1765088..1766089)
Genome map
AA seq 333 aa AA seqDB search
MMSMKQKIFVLYTGGTIGMTQSSEGLRPDTALVSQALSPFSDGLDFEWHVCNPLIDSSSV
TLQHWRDWLDIIADKLPSCDGILILHGTDSMAYTANLLALALQGLGKPIVLTGSQWPYAA
ENSDAPRNLSTAVAAFSLKLKQTVIAFDGKLYPAVGSSKVSTETAAGFDNPHFGTLAEWD
ETRGWHNLRLPSQDAAAVSDGLKIRYPDPQAKIAVRTLIPGFAVQELADGLGQLPAQALI
LQSYGHGNTPADEGFIRAVRDFARQGKLLLNISQVRQGKTAAVYAQGNAFRNSGIINGGK
CNLETATALMTLAVSQGWGKEDVYKELVRLKLV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccatgaaacaaaaaatcttcgtcctctacacaggcggcaccataggcatgacc
caaagcagcgaaggcctgcgccccgataccgcactggttagccaagccctttcccccttt
tcagacggcctcgatttcgagtggcacgtctgcaatcccttgattgattcctcctccgtt
acgctgcaacactggcgcgattggctggacatcattgccgacaaactcccttcatgcgac
ggcatcctgatactgcacggcacggacagcatggcgtacaccgccaatctcctcgcgctc
gctctgcaaggtttgggcaaaccgattgtcctgactggttcccaatggccttacgccgcc
gaaaacagcgatgccccgcgcaacctctccaccgccgttgccgccttcagcctcaagctc
aaacaaaccgtcatcgcgtttgacggcaaactgtatcccgccgtcggcagcagcaaagtc
agcaccgaaactgctgcaggcttcgacaatccgcatttcggcacgcttgccgaatgggac
gaaacccggggttggcacaatcttcgcctcccgtcccaagacgcagcagccgtttcagac
ggcctcaaaatccgttatcccgacccgcaggcaaaaatcgctgtccgcacgcttatcccc
ggctttgccgtccaagaacttgcggacggactcggacagcttcccgcccaagctcttatc
ctgcaaagctacggacacggcaacacgcccgcagacgaaggttttatccgcgccgtccga
gacttcgcgcggcagggcaaactgctgctcaacatcagccaagtccgacaaggcaaaacc
gccgccgtttacgcgcaaggcaacgcgttccgcaactcgggcatcatcaacggcggcaaa
tgcaacctcgaaaccgccaccgcgctgatgaccctcgccgtatcgcaaggctggggtaag
gaagatgtttacaaagaattggtaagactaaagttagtgtga

DBGET integrated database retrieval system