KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1703Help
Entry
NMB1703           CDS       T00027                                 

Gene name
fabF-2
Definition
(RefSeq) 3-oxoacyl-ACP synthase
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00061  Fatty acid biosynthesis
nme00780  Biotin metabolism
nme01100  Metabolic pathways
nme01212  Fatty acid metabolism
Module
nme_M00083  Fatty acid biosynthesis, elongation
nme_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB1703 (fabF-2)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB1703 (fabF-2)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     NMB1703 (fabF-2)
Lipid biosynthesis proteins [BR:nme01004]
 Fatty acid synthase
  Component type
   NMB1703 (fabF-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-GeneID: 903400
NCBI-ProteinID: NP_274707
UniProt: Q9JY77
Position
1779051..1780301
Genome map
AA seq 416 aa AA seqDB search
MLNTRRVAVTGIGGITAFGRDWQSIQAAFKAEKNAVKYMDWHERFPELEAQLGAPIENYA
PPKHWTRKQLRSMGRVSYLCVDAAEQALADAGLLGDESITDGRMGVACGSSSGSTKDIGD
VGELLLTGTSRNFSANTYVRMMPHTTAANIGIFFGLKGRIIPTSSACSSGSQGIGYAYEA
IKYGLTDMMLAGGGEEFFPSEVYVFDSLYAASRRNGEPEKTPRPYDANRDGLVIGEGAGI
FVLEELEHAKRRGAIIYAELVGYGANSDAYHISTPRPDAQGAILAFQTALQHANLAPEDI
GWINLHGTGTHHNDNMESRAVAAVFGNNTPCTSTKPQTGHTLGAADAIEAAFAWGIADRQ
SNPEGKLPPRLWDGQNDPNLPAINLTGSGSRWETEKRITASSSFAFGGSNCVLIIG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgttgaataccagaagggtcgcagtaacaggcataggcggcattaccgccttcggccgg
gattggcaaagcatacaggcagcattcaaagccgaaaaaaacgccgtcaaatatatggat
tggcacgaacgtttccccgaattggaagcgcaactgggtgcgccgattgaaaattacgcg
ccgccgaaacattggacgcgcaagcagctcagaagtatggggcgcgtgtcgtacctgtgc
gtcgatgcggcggagcaggcgctggcggatgccggtttgctcggggacgaaagcattacc
gacggacggatgggcgttgcctgcggctcttccagcggcagcaccaaagacatcggcgat
gtgggcgaattgttgctgaccggcacgtcgcgcaacttcagcgccaacacctatgtgcgt
atgatgccgcacaccaccgccgccaatatcggcatctttttcgggctgaaagggcgcatc
atcccgacatcgagcgcgtgttcgtccggcagccaaggcataggttatgcctacgaagcc
atcaaatacggtctgaccgatatgatgctggcgggcggaggcgaagaatttttcccgtcc
gaagtgtatgttttcgactcgctttatgccgccagccgccgcaacggcgaaccggaaaaa
accccgcgcccatacgacgcgaaccgcgacgggctggtcatcggcgaaggcgcggggatt
ttcgtgctggaagaattggaacacgccaaacggcgcggtgcgataatttacgccgaactc
gtcggctacggagccaacagcgatgcctaccatatttccacgccccgccccgacgcgcaa
ggcgcaatccttgcctttcagacggcattgcaacacgcaaaccttgcacccgaagacatc
ggctggattaatctgcacggcaccgggacgcaccacaacgacaatatggaaagccgcgcc
gttgcagcggttttcggcaacaatacgccctgcacgtccaccaagccgcaaaccggacac
acgctgggcgcggcggacgcaatcgaagccgcgttcgcgtggggcattgccgaccggcaa
agcaatcccgaaggaaaacttccgccccggctttgggacgggcagaacgaccccaacctg
cccgccatcaacctgaccggcagcggcagccgctgggaaaccgaaaaacgcattaccgcc
agctcgtcgtttgccttcggaggaagcaactgcgtcttaatcatcggatga

DBGET integrated database retrieval system