KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1704Help
Entry
NMB1704           CDS       T00027                                 

Gene name
lgtF
Definition
(RefSeq) beta-1,4-glucosyltransferase
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_4 Glyco_tranf_2_2 Glyco_tranf_2_3
Motif
Other DBs
NCBI-GeneID: 903398
NCBI-ProteinID: NP_274708
UniProt: Q9JY76
Position
1780505..1781263
Genome map
AA seq 252 aa AA seqDB search
MKKVSVLIVAKNEANHIQECIESCRFDKEVIVIDDYSTDNTAEIAEGLGAKVFRRHLNGD
FGAQKTFAIEQAGGEWVFLIDADERCTPELSDEISKIVQTGDYAAYFVERRNLFPNHPAT
HGAMRPDSVCRLMPKKDSSVQGKVHETVQTPYPKRRLKHFMYHYTYDNWEQYFNKFNKYT
SISAEKYREQGKPVRFVRDIILRPIWGFFKIYILNKGFLDGKMGWIMSVNHSYYTMIKYV
KLYYLYKSGGKF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtcagcgtattgattgttgccaaaaacgaagcaaaccacattcaggaatgt
attgaaagttgccgtttcgataaagaagttatcgttatcgacgactacagcaccgacaat
actgccgaaattgccgagggtttgggcgcaaaagtcttcagacggcatttgaatggggat
ttcggagcgcaaaaaacatttgccatcgaacaggcaggcggagaatgggttttcctgatt
gatgcagacgaacgctgcacgccggaactatctgatgaaatctcaaaaattgtccaaacc
ggcgattatgccgcctattttgtcgaacgccgcaaccttttccccaaccatcccgccaca
cacggcgcgatgcgtcccgacagcgtatgccgtctgatgccgaaaaaagacagttcggtg
caaggcaaagtacacgaaaccgtacaaaccccctaccccaaacgccgtctgaagcatttt
atgtaccattacacgtacgacaactgggaacaatatttcaacaagttcaacaaatatact
tccatttcagccgaaaaataccgagagcagggaaagcccgtgcgtttcgttagggacatt
atcctccgcccgatttgggggtttttcaaaatttatatcctgaacaaagggtttcttgat
ggaaaaatgggttggattatgtccgtcaaccacagctattacacgatgattaaatatgtc
aaactatattatctgtacaaatccggcggaaaattttaa

DBGET integrated database retrieval system