KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1709Help
Entry
NMB1709           CDS       T00027                                 

Gene name
thyA
Definition
(RefSeq) thymidylate synthase
  KO
K00560  
thymidylate synthase [EC:2.1.1.45]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB1709 (thyA)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NMB1709 (thyA)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     NMB1709 (thyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1784892..1785686)
Genome map
AA seq 264 aa AA seqDB search
MKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTKKLHLRSIIHELL
WFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQWRNWPAPDGRHIDQIANVLEQIK
KNPDSRRLIVSAWNPALVDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS
YALLTMMMAQVCGLEAGEFVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLF
SFKFEDFELEGYDPHPHIKAAVSV
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctatttggacttgatgcgccacgtcctcgacaacggtacggacaaatcagac
cgcaccggtacgggtacgcgctccgtattcggttatcagatgcgttttgacttgggcaaa
ggttttccgctgctgacgaccaaaaagctgcatctgcgttcgattatccacgagctgctt
tggtttctcaaaggcgataccaatatcaaatacctaaaggacaacaatgtttccatttgg
gacgagtgggcggacgaaaacggcgacttaggcccggtttacggctaccagtggcgtaac
tggcccgcgcccgacggcaggcatatcgaccaaatcgccaatgtgctggaacaaatcaag
aagaatcccgactcgcgccgcctgattgtatcggcgtggaatccggctttggtcgatgaa
atggccttgccgccctgccacgcgctgtttcagttttacgttgccgacggcaaactgtcc
tgccagctttaccagcgtagtgcagatattttccttggtgtgccgtttaatattgccagc
tacgcattgttgaccatgatgatggcgcaagtgtgcggattggaggcgggcgagtttgtc
catacgtttggcgacgcgcatttgtaccgcaaccatttcgagcaggccgcattgcagttg
gaacgcgaaccgcgcgccttgccagtgatgaaaatcaatcctgaagtcaaagatttgttt
tccttcaagtttgaagatttcgagttggaaggttacgaccctcatccgcatatcaaggcg
gcagtgtcggtttag

DBGET integrated database retrieval system