KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1710Help
Entry
NMB1710           CDS       T00027                                 

Gene name
gdhA
Definition
(RefSeq) glutamate dehydrogenase
  KO
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    NMB1710 (gdhA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB1710 (gdhA)
   00220 Arginine biosynthesis
    NMB1710 (gdhA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     NMB1710 (gdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1786070..1787404
Genome map
AA seq 444 aa AA seqDB search
MTDLNTLFANLKQRNPNQEPFHQAVEEVFMSLDPFLAKNPKYTQQSLLERIVEPERVVMF
RVTWQDDKGQVQVNRGYRVQMSSAIGPYKGGLRFHPTVDLGVLKFLAFEQVFKNALTTLP
MGGGKGGSDFDPKGKSDAEVMRFCQAFMTELYRHIGADTDVPAGDIGVGGREIGYLFGQY
KKIRNEFSSVLTGKGLEWGGSLIRPEATGYGCVYFAQAMLQTRNDSFEGKRVLISGSGNV
AQYAAEKAIQLGAKVLTVSDSNGFVLFPDSGMTEAQLAALIELKEVRRERVATYAKEQGL
QYFEKQKPWGVAAEIALPCATQNELDEEAAKTLLANGCYVVAEGANMPSTLGAVEQFIKA
GILYAPGKASNAGGVATSGLEMSQNAIRLSWTREEVDQRLFGIMQSIHESCLKYGKVGDT
VNYVNGANIAGFVKVADAMLAQGF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgactgacctgaacaccctgtttgccaacctcaaacaacgcaatcccaatcaggagccg
ttccatcaggcggttgaagaagtcttcatgagtctcgatccgtttttggcaaaaaatccg
aaatacacccagcaaagcctgctggaacgcatcgtcgaacccgaacgcgtcgtgatgttc
cgcgtaacctggcaggacgataaagggcaagtccaagtcaaccggggctaccgcgtgcaa
atgagttccgccatcggtccttacaaaggcggcctgcgcttccatccgaccgtcgatttg
ggcgtattgaaattcctcgcttttgaacaagtgttcaaaaacgccttgaccaccctgcct
atgggcggcggcaaaggcggttccgacttcgaccccaaaggcaaatccgatgccgaagta
atgcgcttctgccaagcctttatgaccgaactctaccgccacatcggcgcggacaccgat
gttccggccggcgacatcggcgtaggcgggcgcgaaatcggctacctgttcggacaatac
aaaaaaatccgcaacgagttttcttccgtcctgaccggcaaaggtttggaatggggcggc
agcctcatccgtcccgaagcgaccggctacggctgcgtctatttcgcccaagcgatgctg
caaacccgcaacgatagttttgaaggcaaacgcgtcctgatttccggctccggcaatgtg
gcgcaatacgccgccgaaaaagccatccaactgggtgcgaaagtactgaccgtttccgac
tccaacggcttcgtcctcttccccgacagcggtatgaccgaagcgcaactcgccgccttg
atcgaattgaaagaagtccgccgcgaacgcgttgccacctacgccaaagagcaaggtctg
caatactttgaaaaacaaaaaccgtggggcgtcgccgccgaaatcgccctgccctgcgcg
acccagaacgaattggacgaagaagccgccaaaaccctgttggcaaacggctgctacgtc
gttgccgaaggtgcgaatatgccgtcgactttgggcgcggtcgagcaatttatcaaagcc
ggcatcctctacgccccgggaaaagcctccaatgccggcggcgtggcaacttcaggtttg
gaaatgagccaaaacgccatccgcctgtcttggactcgtgaagaagtcgaccaacgcctg
ttcggcatcatgcaaagcatccacgaatcctgtctgaaatacggcaaagtcggcgacaca
gtaaactacgtcaatggtgcgaacattgccggtttcgtcaaagttgccgatgcgatgctg
gcgcaaggcttctaa

DBGET integrated database retrieval system