KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1714Help
Entry
NMB1714           CDS       T00027                                 

Gene name
mtrE
Definition
(RefSeq) multidrug efflux pump channel protein
  KO
K18139  
outer membrane protein, multidrug efflux system
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
beta-Lactam resistance
Quorum sensing
Module
Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Brite
KEGG Orthology (KO) [BR:nme00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NMB1714 (mtrE)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    NMB1714 (mtrE)
Transporters [BR:nme02000]
 Other Transporters
  Pores ion channels [TC:1]
   NMB1714 (mtrE)
Antimicrobial resistance genes [BR:nme01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    NMB1714 (mtrE)
   Multidrug resistance, efflux pump MexJK-OprM [MD:M00642]
    NMB1714 (mtrE)
   Multidrug resistance, efflux pump MexXY-OprM [MD:M00643]
    NMB1714 (mtrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1790509..1791912)
Genome map
AA seq 467 aa AA seqDB search
MDTTLKTTLTSVAAAFALSACTMIPQYEQPKVEVAETFKNDTADSGIRAVDLGWHDYFAD
PRLQKLIDIALERNTSLRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSLSGGNVS
SSYKVGLGAASYELDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAE
EAMSLAQRVLKTREETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARN
ALATLINQPIPEDLPAGLPLDKQFFVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGA
ARAAFFPSIRLTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQ
QVQIVAYESAVQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGA
LDLLDAERSSYAAEGAALSAQLTRAENLADLYKALGGGLKRDTQTDK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggatactacattgaaaaccaccttgacttctgttgcagcagcctttgcattgtctgcc
tgcaccatgattccccaatacgagcagcccaaagtcgaagttgccgaaacgttcaaaaac
gataccgccgacagcggcatccgcgccgtcgatttaggttggcatgactattttgccgac
ccgcgcctgcaaaagctgatcgacatcgcactcgagcgcaataccagtttgcgtaccgcc
gtattgaacagcgaaatctaccgcaaacaatacatgattgagcgcaacaacctcctgccc
acgcttgccgccaatgcgaacgactcgcgccaaggcagcttgagcggcggcaatgtaagc
agcagctacaaagtcggactgggtgcggcatcttacgaactcgatctgttcgggcgtgta
cgcagcagcagcgaggcggcactgcaaggctatttcgccagcaccgccaaccgcgatgcg
gcacatttgagcctgattgccaccgttgccaaagcctatttcaacgaacgttacgccgaa
gaagcgatgtctttggcgcaacgtgttttgaaaacgcgcgaggaaacctacaagctgtcc
gaattacgttacaaggcaggcgtgatttccgccgtcgccctacgtcagcaggaagccctg
atcgaatctgccaaagccgattatgcccatgccgcgcgcagccgcgaacaggcgcgcaat
gccttggcaaccttgattaaccaaccgatacccgaagacctgcctgccggtttgccgctg
gacaagcagttttttgttgaaaaactgccggccggtttgagttccgaagtattgctcgac
cgtcccgatatccgtgctgccgaacacgcgctcaaacaggcaaacgccaatatcggtgcg
gcacgcgccgcctttttcccatccatccgcctgaccggaaccgtcggtacgggttctgcc
gaattgggtgggttgttcaaaagcggcacgggcgtttggtcgttcgcgccgtctattacc
ctgccgatttttacctggggtacgaacaaggcgaaccttgatgtagccaagctgcgccaa
caggtacaaatcgttgcctatgaatccgccgtccaatccgcatttcaagacgtggcaaac
gcattggcggcgcgcgagcagctggataaagcctatgacgctttaagcaaacaaagccgc
gcctctaaagaagcgttgcgcttggtcggcctgcgttacaagcacggcgtatccggcgcg
ctcgacttgctcgatgcggaacgcagcagctatgcggcggagggtgcggctttgtcggca
caactgacccgcgccgaaaaccttgccgatttgtacaaggcactcggcggcggattgaaa
cgggatacccaaaccgacaaataa

DBGET integrated database retrieval system