KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1719Help
Entry
NMB1719           CDS       T00027                                 

Gene name
mtrF
Definition
(RefSeq) efflux pump component MtrF
  KO
K12942  
aminobenzoyl-glutamate transport protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1798278..1799846
Genome map
AA seq 522 aa AA seqDB search
MSQTDTQRDGRFLRTVEWLGNMLPHPVTLFIIFIVLLLIASAVGAYFGLSVPDPRPVGAK
GRADDGLIYIVSLLNADGFIKILTHTVKNFTGFAPLGTVLVSLLGVGIAEKSGLISALMR
LLLTKSPRKLTTFMVVFTGILSNTASELGYVVLIPLSAIIFHSLGRHPLAGLAAAFAGVS
GGYSANLFLGTIDPLLAGITQQAAQIIHPDYVVGPEANWFFMVASTFVIALIGYFVTEKI
VEPQLGPYQSDLSQEEKDIRHSNEITPLEYKGLIWAGVVFVALSALLAWSIVPADGILRH
PETGLVSGSPFLKSIVVFIFLLFALPGIVYGRVTRSLRGEQEVVNAMAESMSTLGLYLVI
IFFAAQFVAFFNWTNIGQYIAVKGATFLKEVGLGGSVLFIGFILICAFINLMIGSASAQW
AVTAPIFVPMLMLAGYAPEVIQAAYRIGDSVTNIITPMMSYFGLIMATVIKYKKDAGVGT
LISMMLPYSAFFLIAWIALFCIWVFVLGLPVGPGAPTFYPAP
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccgatacgcaacgggacggacgatttttacgcacagtcgaatggctgggc
aatatgttgccgcatccggttacgctttttattattttcattgtgttattgctgattgcc
tctgccgtcggtgcgtatttcggactatccgtccccgatccgcgccctgttggtgcgaaa
ggacgtgccgatgacggtttgatttacattgtcagcctgctcaatgccgacggttttatc
aaaatcctgacgcataccgttaaaaatttcaccggtttcgcgccgttgggaacggtgttg
gtttctttattgggcgtggggattgcggaaaaatcgggcttgatttccgcattaatgcgc
ttattgctcacaaaatcgccacgcaaactcactacttttatggttgtttttacagggatt
ttatctaataccgcttctgaattgggctatgtcgtcctaatccctttgtccgccatcatc
tttcattccctcggccgccatccgcttgccggtctggctgcggctttcgccggcgtttcg
ggcggttattcggccaatctgttcttaggcacaatcgatccgctcttggcaggcatcacc
caacaggcggcgcaaatcatccatcccgactacgtcgtaggccctgaagccaactggttt
tttatggtagccagtacgtttgtgattgctttgattggttattttgttactgaaaaaatc
gtcgaaccgcaattgggcccttatcaatcagatttgtcacaagaagaaaaagacattcgg
cattccaatgaaatcacgcctttggaatataaaggattaatttgggctggcgtggtgttt
gttgccttatccgccctattggcttggagcatcgtccctgccgacggtattttgcgtcat
cctgaaacaggattggtttccggttcgccgtttttaaaatcgattgttgtttttattttc
ttgttgtttgcactgccgggcattgtttatggccgggtaacccgaagtttgcgcggcgaa
caggaagtcgttaatgcgatggccgaatcgatgagtactctggggctttatttggtcatc
atcttttttgccgcacagtttgtcgcattttttaattggacgaatattgggcaatatatt
gccgttaaaggggcgacgttcttaaaagaagtcggcttgggcggcagcgtgttgtttatc
ggttttattttaatttgtgcttttatcaatctgatgataggctccgcctccgcgcaatgg
gcggtaactgcgccgattttcgtccctatgctgatgttggccggctacgcgcccgaagtc
attcaagccgcttaccgcatcggtgattccgttaccaatattattacgccgatgatgagt
tatttcgggctgattatggcgacggtgatcaaatacaaaaaagatgcgggcgtgggtacg
ctgatttctatgatgttgccgtattccgctttcttcttgattgcgtggattgccttattc
tgcatttgggtatttgttttgggcctgcccgtcggtcccggcgcgcccacattctatccc
gcaccttaa

DBGET integrated database retrieval system