KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1723Help
Entry
NMB1723           CDS       T00027                                 

Gene name
fixP
Definition
(RefSeq) cytochrome c oxidase subunit III
  KO
K00406  
cytochrome c oxidase cbb3-type subunit III
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome c oxidase, cbb3-type
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    NMB1723 (fixP)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NMB1723 (fixP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1805070..1806167)
Genome map
AA seq 365 aa AA seqDB search
MNTTSQFTSNFWNIYIAVIVLLSFIALAWLLLSQNVVKRPKKGEEVQTTGHEWDGIAEYD
NPLPRWWFWLCVLTWLFGIGYLVMYPGVGDYKGLLKWTSHNQYEKEVKKADEQYGKLYAK
FADMPIEKVAKDPQAKQIAQNLFNTYCIQCHGSDAKGSKGFPNLTDSDWLWGGDPDKIHE
TIEKGRVATMPAWGPALGEEGVKDVAHYVMSLSKPEGQYDEERAARGQALFSGPPANCFT
CHGDKGQGIQGLGPNLTDDVWLWGGTQKSIIETITNGRSSQMPAWGHFLDKDKLHIMTAY
VWGLSDKDGKAPVKKAEPAPTPAPAAEPAASAPAEAAQAVSEAKPAAAEPKAEEKAAPAA
KADGK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaacatcccaatttaccagtaatttctggaatatatatattgcagttattgtc
ttactgagctttatcgctttggcttggctgctgctgtctcaaaatgttgtcaaacgtccg
aagaagggcgaagaagtacaaactacgggtcatgagtgggacggcattgccgaatacgac
aatccgctgccccgctggtggttttggctgtgtgttttgacgtggctgttcggtatcggt
tatttggttatgtatccgggtgtcggcgactacaaaggtctgctgaaatggaccagccat
aaccaatatgaaaaagaggtcaaaaaagccgatgagcaatacggcaaactgtatgccaag
tttgcggatatgccgattgaaaaagtggcaaaagaccctcaagccaagcaaatcgcccaa
aacctgtttaacacttattgtatccagtgccacggctctgatgctaaaggctctaaaggt
tttccgaatctgaccgatagcgattggttgtggggcggtgatcccgataaaatccacgag
accatcgaaaaaggccgtgttgcgactatgcctgcctggggtcctgctttgggcgaagaa
ggcgtgaaagacgttgcccattatgtgatgtccctttcaaaacccgaaggtcagtatgat
gaggaacgtgccgcgcgcggacaagccttgttcagcggtccgcctgccaactgtttcact
tgccacggcgataagggacaaggtatccaaggtttgggtccgaacctgactgatgacgtg
tggttgtggggcggtacgcaaaaatccattatcgaaaccattaccaacggtcgcagcagc
caaatgcccgcttggggacatttcttggataaagacaaactgcatattatgactgcttat
gtatggggtctttccgataaagacggtaaagctccggtgaaaaaagccgagcctgcaccg
actcccgcaccggcggcagaacccgcagcctctgctcctgcagaagcagcacaagccgtg
tccgaagccaaacctgccgcagcagaacctaaagccgaggaaaaagctgcacctgctgcc
aaagcggacggcaaatag

DBGET integrated database retrieval system