KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1732Help
Entry
NMB1732           CDS       T00027                                 

Definition
(RefSeq) transporter
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1815044..1815844)
Genome map
AA seq 266 aa AA seqDB search
MKKTIFNITKMDCPSEEQLIRMRLKDVSDIYELQFDIAGRCLTVYHDNQDTTILQVLEPL
NFDSHIISTEVIVDKIVFNKPDEHLEKRLLYQVLMINFVFFIIECSVGIFANSMGLIADS
LDMLADSFVYILALSAIGMTLAYKKRVAFLAGITQIILALFGVIEVIRRFIGAEQLPNYQ
LMIGTAFLALIANWLCLYLLSKNQNKEIHIKASMIFTSNDIIINIGVIAAGALTLLTHSS
YPDLIIGMIVFVIVLFGARNILKLAK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaccatttttaacattaccaaaatggactgcccgtccgaagaacagctcatt
cgcatgcgtttaaaagatgtgtctgatatttatgaattacagtttgatattgctgggcgg
tgcttaaccgtctatcacgataatcaagatacaacgattttacaagtacttgaaccgctt
aattttgatagtcatatcatttccaccgaagtgattgttgataagatagtgtttaacaag
cctgatgagcacttagaaaaaagattattatatcaagtgctcatgattaactttgtgttt
tttatcatagagtgttcggttggtatttttgctaattctatggggctgattgctgatagt
ctagatatgctggcggacagctttgtctatatattggcgctatcagccattggtatgacg
ctggcgtataaaaaacgtgtggcatttttggcggggataacgcagataatattggcgtta
tttggggtgatagaagtgattaggcgttttatcggtgctgagcagctgcccaattatcaa
ctgatgattggcacggcatttttggcattgattgcaaactggctgtgcttatatctactg
agcaaaaatcaaaataaagaaatccatatcaaagccagcatgatttttacatccaatgac
attatcatcaatatcggtgtgatagcggcgggagcattgacgttattgactcattctagc
tatcctgatttaatcattggcatgattgtctttgtcattgtactatttggtgccagaaat
attttaaaattggcaaaataa

DBGET integrated database retrieval system