KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1787Help
Entry
NMB1787           CDS       T00027                                 

Gene name
argC
Definition
(RefSeq) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  
N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NMB1787 (argC)
   01230 Biosynthesis of amino acids
    NMB1787 (argC)
  Amino acid metabolism
   00220 Arginine biosynthesis
    NMB1787 (argC)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     NMB1787 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1874194..1875237
Genome map
AA seq 347 aa AA seqDB search
MSKKIKVGIVGATGYTGVELLRLLAAHPDVEVAAVTSRSEAGTAVADYFPSLRGVYGLAF
QTPDEAGLEQCDIVFFATPNGIAMKDAPRLIEQGVRVIDLSADFRIRDIPTWEHWYGMTH
AAPDLVSQAVYGLSELNREAVAQARLVANPGCYPTCVSLPLVPLLRQCRLKPGMPLIADC
KSGVSGAGRKGNVGSLLCEAGDNFKAYGIAGHRHLPEIRQTIAGLQDGIAEGFVFTPHLA
PMIRGMHATVYLHLSDGSDPETVLRDYYRDSPFVDILPTGSAPETRSVRGANLCRISIQQ
AAQSDVWVVLSVIDNLVKGAAGQAVQNMNIMFGLEETHGLDAIPLLP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaaatcaaagtcggcattgtcggcgcgacgggctacaccggcgtggaactg
ctgcgcctgcttgccgcccatcccgatgtcgaagtcgccgccgtaaccagccgcagcgaa
gcgggaaccgcagttgccgattactttccgagtttgcgcggcgtgtacggcctcgccttc
caaacgcccgacgaggcaggtttggaacaatgcgacatcgtcttcttcgccacgcccaac
ggcatcgccatgaaagacgcgccgcgcctgattgaacagggcgtgcgcgtcatcgacctt
tccgccgacttccgcatacgggacattccgacctgggaacactggtacggcatgacccac
gccgcccccgacctcgtttcccaagccgtgtacggattgagcgaactcaaccgcgaagcc
gtcgcacaggcgcgcctcgtcgccaaccccggctgctacccgacctgcgtatccctaccg
ctcgtgccgctgttgcggcaatgccgtctgaagcccggtatgccgctgattgccgactgc
aaatccggtgtgtccggcgcgggcaggaaaggcaatgtcggttcgctgttgtgcgaagcc
ggcgacaacttcaaagcctacggcatagccggacaccgccacctgcccgaaatcaggcag
accatcgccgggcttcaggacggcatcgccgaaggattcgtgttcacgccgcacctcgcg
ccaatgatacgcggtatgcacgccaccgtttacctccacctttcagacggcagcgacccc
gaaaccgtcctgcgcgactactaccgcgacagcccgttcgtggacatcctgccgaccggt
tccgcccccgaaacccgcagcgtgcgcggcgcaaacctctgccgcatcagcatccaacag
gcggcgcaatccgatgtgtgggtcgtcctttccgtcatcgacaacctcgtcaaaggcgcg
gcgggtcaggcagtccaaaatatgaacattatgttcggactggaggaaacacacggcttg
gacgcaatccccctgctcccctga

DBGET integrated database retrieval system