KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1794Help
Entry
NMB1794           CDS       T00027                                 

Definition
(RefSeq) citrate transporter
  KO
K03300  
citrate-Mg2+:H+ or citrate-Ca2+:H+ symporter, CitMHS family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1882534..1883847)
Genome map
AA seq 437 aa AA seqDB search
MLTFIGLLIIGVIVWLLLTEKVSPIIALILVPLFGALLAGFDVSQLKEFYSGGTKSVMQI
VIMFMFSILFFGIMNDVGLFRPMIGGLIKLTRGNIVAVSVGTVLVSVVAQLDGAGATTFL
LVVPALLPLYKRLHMNPYLLFLLLTSSAGLINLLPWGGPTGRVASVLGADVGELYKPLLT
VQIIGVVFILALSLLLGVREKRRIVRELGALPAVADLIKPVPLSEEEQKLARPKLFWWNV
LLFLAAMSLLFSGIFPPGYVFMLAATAALLLNYRSPQEQMERIYAHAGGAVMMASIILAA
GTFLGILKGAGMLDAISKDIVHILPDALLPYLHIAIGVLGIPLELVLSTDAYYFGLFPIV
EQITSQAGVAPEAAGYAMLIGSIVGTFVTPLSPALWMGLGLAKLSMGKHIRYSFFWAWGL
SLAILASSIAAGIVPLP
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgtttatcggactgctgattatcggggtcatcgtatggctgctgctgacggaa
aaagtgtcgcccatcatcgcattaatcttggtgccgctgtttggggcgttgctggcgggg
tttgatgtatcccaattaaaagaattttattcgggcggcaccaaatcggtgatgcagatt
gtgattatgtttatgttttccattttgttttttggaatcatgaacgatgtggggctgttc
cgtccgatgataggcggtttgattaagctgactcggggtaatatcgtggcagtgagtgtg
gggacggtcttggtgtcggtggtggcgcagttggacggggcgggtgcgacgacgttttta
ttggtcgtccccgcccttttgccgctttacaagcgtctgcatatgaatccttacctgctg
tttttgctgctgacttccagtgcgggattgattaaccttctgccgtggggcgggccgacc
gggcgggttgcaagcgtgttgggcgcagatgtgggcgaattgtataaacctttgttgacg
gtgcaaattatcggtgtggtgtttatccttgcgctgtccctgcttttgggtgtgcgtgaa
aaaaggcggattgtccgggagttgggcgcgttgcccgccgtggcggatttgataaagccg
gtgcctttgtcggaagaagaacaaaaattggcgcgtccgaaactgttttggtggaatgtc
ctgctgtttttggcggcgatgagcctgcttttttcgggcatcttcccaccgggttatgta
tttatgctggctgcaacggcggcgttgcttttgaattaccgcagcccgcaggaacagatg
gagcggatttatgcccacgccggcggcgcggtgatgatggcgtccattattttggcggca
ggtacgtttttggggattttgaagggtgcggggatgttggacgcgatttccaaagacatt
gtgcatatcctgccggacgcgctgctgccttatctgcatattgccatcggtgtgttgggc
attccgcttgagttggttttgagtacggacgcttattatttcggactgtttccgattgtg
gagcagattacctcgcaggcgggcgtggcgcccgaagcagcaggttatgcgatgttgatc
ggcagtatcgtcggcacttttgttacgccgctttcgccggctttgtggatgggcttgggt
ttggcgaaattgtcgatgggcaaacacatccgttattcgtttttctgggcgtggggtttg
tcgctggcgatattggccagttcgatagcggcaggaatcgtgcctctgccgtaa

DBGET integrated database retrieval system