KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1799Help
Entry
NMB1799           CDS       T00027                                 

Gene name
metK
Definition
(RefSeq) S-adenosylmethionine synthetase
  KO
K00789  
S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB1799 (metK)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB1799 (metK)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     NMB1799 (metK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1887524..1888693)
Genome map
AA seq 389 aa AA seqDB search
MSEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTT
AQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIAQGVNEGEGIDLNQGAG
DQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETG
KVKRIDTVVLSTQHDPSIAYEELKNAVIEHIIKPVLPSELLTDETKYLINPTGRFVIGGP
QGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQ
IQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVREHFDLRPKGIVQMLDLLRPIYSKSA
AYGHFGREEPEFTWERTDKAAALRAAAGL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatatctgtttacttccgaatcggtatccgaaggccatccggataaagttgcc
gaccaagtatccgatgcgattttggatgccatcttggcgcaagacccaaaagcacgtgtc
gccgcagaaaccttggtcaacacaggcttgtgcgtattggcaggcgaaattaccaccacc
gcccaagtagactacatcaaagtcgcacgcgaaaccatcaaacgcatcggctacaactcc
tccgagctgggctttgatgccaacggctgcgcagtcggcgtgtactacgaccagcaatcc
cccgacatcgcccaaggcgtgaacgaaggcgaaggcatcgacttgaaccagggcgcgggc
gaccaaggtttgatgttcggctatgcctgtgacgaaacccctaccctgatgccgtttgcc
atctattacagccaccgcctgatgcagcgtcaaagcgaattgcgcaaagacggccgcctg
ccttggctgcgtcctgatgccaaagcccaactgaccgtggtttacgacagcgaaaccggc
aaagtaaaacgcatcgacaccgtcgtcctgtctacccagcacgatccgtccatcgcttac
gaagagctgaaaaacgccgtaatcgaacacatcatcaaaccggttctgccgtctgaactg
ctgaccgacgaaaccaaatacctgatcaacccgaccggccgcttcgttatcggcggcccg
caaggcgactgcggtttgaccggccgtaaaatcatcgtcgatacctacggcggcgcggct
ccgcacggcggcggcgcattctccggcaaagacccgtccaaagtggaccgttccgccgct
tacgcctgccgctatgtcgcaaaaaacatcgtcgccgcaggtttggcaacccaatgccaa
atccaagtttcctacgccatcggcgttgccgaaccgacttcgatttccatcgatactttc
ggcaccggcaaaatcagcgaagaaaaactgattgccttagttcgcgaacatttcgacctg
cgccccaaaggcatcgtccaaatgctcgatctcttgcgcccgatttacagtaaatccgcc
gcttacggacatttcggccgcgaagaacctgagttcacttgggagcgcaccgacaaagct
gctgcattgagggcggcagcggggctgtaa

DBGET integrated database retrieval system