KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1801Help
Entry
NMB1801           CDS       T00027                                 

Definition
(RefSeq) lipid A biosynthesis lauroyl acyltransferase
  KO
K02517  
Kdo2-lipid IVA lauroyltransferase [EC:2.3.1.241]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB1801
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.241  Kdo2-lipid IVA lauroyltransferase
     NMB1801
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Lipid A
  NMB1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1889039..1889935
Genome map
AA seq 298 aa AA seqDB search
MFRLQFRLFPPLRTAMHILLTALLKCLSLLPLSCLHTLGNRLGHLAFYLLKEDRARIVAN
MRQAGLNPDPKTVKAVFAETAKGGLELAPAFFRKPEDIETMFKAVHGWEHVQQALDKHEG
LLFITPHIGSYDLGGRYISQQLPFPLTAMYKPPKIKAIDKIMQAGRVRGKGKTAPTSIQG
VKQIIKALRSGEATIVLPDHVPSPQEGGEGVWVDFFGKPAYTMTLAAKLAHVKGVKTLFF
CCERLPGGQGFDLHIRPVQGELNGDKAHDAAVFNRNAEYWIRRFPTQYLFMYNRYKMP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtttacaattcaggctgtttccccctttgcgaaccgccatgcacatcctgttg
accgccctgctcaaatgcctctccctgctgccgctttcctgtctgcacacgctgggaaac
cggctcggacatctggcgttttaccttttaaaggaagaccgcgcgcgcatcgtcgccaat
atgcggcaggcgggtttgaaccccgaccccaaaacggtcaaagccgtttttgcggaaacg
gcaaaaggcggtttggaacttgcccccgcgtttttcagaaaaccggaagacatagaaaca
atgttcaaagcggtacacggctgggaacatgtgcagcaggctttggacaaacacgaaggg
ctgctattcatcacgccgcacatcggcagctacgatttgggcggacgctacatcagccag
cagcttccgttcccgctgaccgccatgtacaaaccgccgaaaatcaaagcgatagacaaa
atcatgcaggcgggcagggttcgcggcaaaggaaaaaccgcgcctaccagcatacaaggg
gtcaaacaaatcatcaaagccctgcgttcgggcgaagcaaccatcgtcctgcccgaccac
gtcccctcccctcaagaaggcggggaaggcgtatgggtggatttcttcggcaaacctgcc
tataccatgacgctggcggcaaaattggcacacgtcaaaggcgtgaaaaccctgtttttc
tgctgcgaacgcctgcctggcggacaaggtttcgatttgcacatccgccccgtccaaggg
gaattgaacggcgacaaagcccatgatgccgccgtgttcaaccgcaatgccgaatattgg
atacgccgttttccgacgcagtatctgtttatgtacaaccgctacaaaatgccgtaa

DBGET integrated database retrieval system