KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1814Help
Entry
NMB1814           CDS       T00027                                 

Gene name
aroB
Definition
(RefSeq) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB1814 (aroB)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     NMB1814 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-GeneID: 903286
NCBI-ProteinID: NP_274811
UniProt: Q9JY01
Position
1905446..1906525
Genome map
AA seq 359 aa AA seqDB search
MKTLTVHTPSHSYPIFIGNGLLPQAGSLLKPHLGKRAAIIANETVAPLYLGTLQTALDAA
GVSHFSIILPDGEAHKNWQTLNLIFDGLMQNRAERKTTLIALGGGVIGDMVGFAAATYQR
GAPFVQIPTTLLSQVDSSVGGKTAINHPLGKNMIGAFYQPQAVLADLDTLHTLPARELSA
GMAEVIKYGALGDIGFFEWLEQHMPELMTLDREKLAQAVYRCCQMKADIVAQDETEQGIR
AWLNLGHTFGHAIETEMGYGTWLHGEAIAAGCVLAARLSEQLGKTSAADTARLAALLEAA
GLPSAPPVFAFEKWLEHMSHDKKVSGGIMRFIGLNRLGEANITEITDTDILRRTLQPYL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactgaccgtacacaccccgtcccacagctaccccatctttatcggcaacgga
ctgctgccgcaggcaggaagcctgctcaaaccgcatttgggcaaacgcgccgccatcatc
gccaacgaaaccgtcgccccgctctacctcggcacgcttcagacggcattggatgcggca
ggcgtatcccatttcagcatcatcctgcccgacggcgaggcgcacaaaaactggcagacg
ctcaacctcatctttgacgggctgatgcaaaaccgcgccgaacgcaaaaccacattaatc
gcactgggcggcggcgtgatcggcgacatggtcggctttgccgctgccacctaccagcgc
ggcgcaccgttcgttcaaataccgaccacgctgttgagtcaggtcgactcatcggtgggc
ggcaaaaccgccatcaaccacccgctcggcaaaaatatgattggcgcgttttaccagccg
caggcggtgcttgccgacttggacacgctgcacaccctgcccgcccgcgaattgtccgcc
ggtatggcggaagtcatcaaatacggcgcgctcggcgacatcggcttttttgaatggctg
gaacagcatatgcccgaactgatgacgctcgatcgggaaaaactcgcccaagccgtgtac
cgctgctgccaaatgaaggcagacatcgtcgcccaagacgaaaccgaacagggcatacgc
gcatggctcaacctcggacacaccttcggacacgccattgaaaccgagatgggttacggc
acttggctgcatggagaagccatcgccgccggctgcgtgttggcggcgcgtttgtccgaa
caactgggcaaaacctccgccgcagataccgcgcggctcgccgccctgctcgaagccgcc
ggactgccgtccgcgccacccgtgtttgcctttgaaaaatggctggaacacatgagccac
gataaaaaagtcagcggcggcatcatgcgctttatcggtctgaaccggctgggcgaagcc
aacatcaccgaaattaccgacacggacatcctccgccgcaccctgcaaccgtatctctga

DBGET integrated database retrieval system