KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1817Help
Entry
NMB1817           CDS       T00027                                 

Gene name
ribD
Definition
(RefSeq) riboflavin biosynthesis protein RibD
  KO
K11752  
diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Quorum sensing
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NMB1817 (ribD)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NMB1817 (ribD)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     NMB1817 (ribD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     NMB1817 (ribD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1908860..1909969
Genome map
AA seq 369 aa AA seqDB search
MFSDTDISMMENALRLAALGRFSTSPNPRVGCVIAHGSQIVGQGFHVKAGEPHAEVHALR
QAGEMAQGATAFVTLEPCSHYGRTPPCAEALVRAGVSRVVAAMRDPNPLVAGKGLALLEA
AGIKTECGLLEHQARELNRGFLSRIERRRPFVRLKCAVSLDGKTALSDGSSFWITGEDAR
ADVQVLRAESCAVLTGIGTVLADNPRLNVRAFPTLRQPARIVLDSRLRLPPNSHLVTDGQ
SPTYIATLERNEDRLHPYREHAHVRILMPSETADSKIDLHHLMRLLADEGFGEIMVEAGS
ELTSAFLAENLADEIVLYRSPKILGSGKDLFSLLENRAALSAPPLWTPVSSEILGHNIKT
VFRKNGNAF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttttcggacacagatatatccatgatggaaaacgccctccgacttgccgctttgggg
cgtttttccacttcgcccaatccgcgcgtcggctgcgttatcgcacacggcagccaaatt
gtcgggcaaggcttccacgtcaaagcgggcgaaccccatgccgaagtccacgccctgcgt
caggcgggcgaaatggcacaaggcgcgaccgcctttgttaccctcgaaccgtgcagccat
tacgggcgcacaccgccctgtgccgaagcactggtgcgggcgggcgtgtcccgcgtcgtt
gccgccatgcgcgaccccaacccgctggttgcaggcaaagggcttgccctgctcgaagca
gcaggcatcaagacggaatgcggtttactcgaacatcaggcaagggaactcaaccgaggc
ttcctgtcgcgcatcgaacgccgccgcccctttgtccgcctcaaatgcgccgtttcgctg
gacggcaaaaccgccctttcagacggcagcagcttttggattaccggcgaagacgcgcgt
gccgacgtacaggttttgcgtgccgaaagctgcgcggtgctgaccggcatcggcacggtg
ttggcggacaatccccggctcaacgtccgcgcttttccaactttgcgccaacccgcacgc
atcgttttagacagccgcctgcgcctgcccccgaacagccatttggttaccgacggacaa
tctccgacctacatcgccacactcgaacgcaacgaagacagactgcacccctatcgggaa
cacgcacacgtccgcatcctgatgccgtctgaaacggcagacagcaaaatcgacctgcac
cacctgatgcgcctccttgctgacgaaggtttcggcgaaatcatggtcgaagcaggctcc
gaactcacatccgcatttttggcagaaaatctggcagacgaaatcgtcctgtaccgttcg
cccaaaatcctcggcagcggcaaagacctgttttccctgctcgaaaaccgcgccgccctt
tccgcaccgcccttgtggacacccgtttcaagcgaaatcctcggacacaacatcaaaacc
gtgttccgaaaaaacggcaacgccttttaa

DBGET integrated database retrieval system