KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1823Help
Entry
NMB1823           CDS       T00027                                 

Gene name
avtA
Definition
(RefSeq) valine--pyruvate transaminase
  KO
K00835  
valine--pyruvate aminotransferase [EC:2.6.1.66]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NMB1823 (avtA)
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.66  valine---pyruvate transaminase
     NMB1823 (avtA)
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class I
   NMB1823 (avtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1916316..1917608
Genome map
AA seq 430 aa AA seqDB search
MQFSAFGEKFTQHSGILQLMDDLGDALKSDKPVNMLGGGNPARIPEIDQAFADIFSKLAA
EHAVENIGNYSNPQGDAVLIDALTAFLNREYSWNLTADNIALTNGSQNAFFYLFNLFGGK
FNLSDGTSAEKAILLPLAPEYIGYADVHVEGQHFVSVKPKIENVEHEGEAGFFKYRVDFD
ALENLPELKAGKIGAICCSRPTNPTGNVLTDGEMARLDALAREHGIPLIIDNAYGMPFPN
IIYSDVTLNWHENIILCFSLSKVGLPGVRTGIIVAAPEVVKAVSSLNAIVNLAPTRFGAA
IATPLLESGEMKRLADQVIRPFYRNQAQTAVSLLKRELGAYPMKIHKPEGAIFLWLWFEN
LPVSSQTLYEMLKAEGTLIIPGEHFFVGIDTQDYPHAGECIRMSIAQDAQTLEKGIAAIG
KTVRKLYDNV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcagttctcagcattcggcgaaaaattcacgcaacacagcggcatcctccaactgatg
gacgacctcggcgacgcgctcaaaagcgacaagcccgtcaacatgctcggcggcggcaac
ccggcgcgcattccggaaatcgatcaggcgttcgccgacatattctccaaactggcggca
gaacacgccgtcgaaaacatcggcaactactccaatccccaaggcgatgccgtgctgatt
gacgcgctgaccgccttcctcaaccgcgaatacagctggaatctgaccgccgacaatatc
gcgctgaccaacggttcgcaaaacgcgtttttctatcttttcaacctcttcggcggcaaa
ttcaacctttcagacggcacatccgcagaaaaagccattttgttgccgctcgcgcccgaa
tacatcggctatgccgacgtgcatgtcgaagggcagcacttcgtttccgtcaagcccaaa
atcgaaaacgtcgaacacgaaggcgaagccggcttcttcaaataccgcgtggactttgac
gcactggaaaacctgcccgaactcaaagcgggcaaaatcggcgcgatttgctgttcgcgc
ccgaccaacccgaccggcaatgtgttgaccgacggcgaaatggcgcgtttggacgctttg
gcgcgtgaacacggcattccgctgattatcgacaacgcctacggaatgccgttccccaac
atcatttacagcgacgtaacgctgaattggcacgaaaacatcatcctctgcttcagcctg
tccaaagtcggcctgccgggcgtgcgcaccggcatcatcgtcgccgcgcccgaagtcgtc
aaagccgtcagcagcctgaacgcgattgtgaaccttgcccccacgcgcttcggcgcggcc
atcgcaacgccgctgctggaaagcggcgagatgaaacggcttgccgaccaagtcatccgg
ccgttttaccgcaatcaggcgcaaaccgccgtctcgctgctcaagcgggagctgggcgcg
tacccgatgaaaatccacaaacccgaaggcgcgattttcctgtggctctggtttgaaaac
ctgcccgtttcttcgcaaaccctgtacgaaatgctcaaagccgaaggcacactgattatt
ccgggcgaacatttcttcgtcggcatcgacacgcaggattacccgcatgcgggcgagtgc
atccgcatgagcatcgcgcaggacgctcaaacgctggaaaaaggcattgccgccatcggt
aaaaccgtccgaaaactgtacgacaacgtttaa

DBGET integrated database retrieval system