KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1830Help
Entry
NMB1830           CDS       T00027                                 

Definition
(RefSeq) phosphoglycolate phosphatase
  KO
K01091  
phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NMB1830
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     NMB1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1927037..1927696
Genome map
AA seq 219 aa AA seqDB search
MTTPKLIIFDWDGTLADTTQPIIDTMRRSFAECGFPPPEAERVRSLIGYSLPEIIRTLLE
MPSETAVADITRTYSAHYLNPNNRNMSLFPDALPCLDKLKAQGYWLAVATGKGRAGLDNA
ISQTATGGYWLATACAGEYPSKPSPEMVFGICGELGLDPKEALVVGDTAHDLHMAANAGA
AAVGVATGAHSREQLLSAPHLAVLDGLSELPGFLAQHYA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcccaaactcatcatcttcgactgggacggcacgcttgccgatacgacccaa
cccatcatcgacaccatgcgccgcagcttcgccgaatgcggttttccgccgcccgaagcg
gaacgcgtccgcagcctgattggctacagcctgcccgaaatcatccgcaccctgctcgaa
atgccgtctgaaaccgccgttgccgacatcacacgcacttattccgcacattacctcaat
cccaacaaccgcaatatgtccttatttcccgatgccctgccctgtctggacaagctcaaa
gcacaaggatactggcttgccgtcgccacgggcaaagggcgggcgggtttggacaacgcc
atcagtcaaaccgccaccggcggctattggctcgccaccgcctgcgcgggggaatatccc
tccaaaccctcgcccgaaatggtattcggaatctgcggcgaactgggactcgacccgaaa
gaggcattggtcgtcggcgatacggcgcacgacctgcatatggcggcaaacgcaggcgcg
gcggcagtcggcgtggccaccggcgcacattcgcgcgaacagctccttagcgcaccgcat
ctcgccgtattggacggtttgtccgaactgcccggttttcttgcacaacattacgcctga

DBGET integrated database retrieval system