KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1831Help
Entry
NMB1831           CDS       T00027                                 

Gene name
ispH
Definition
(RefSeq) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase
  KO
K03527  
4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [EC:1.17.7.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB1831 (ispH)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.4  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase
     NMB1831 (ispH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1927784..1928752)
Genome map
AA seq 322 aa AA seqDB search
MNEKTIILANPRGFCAGVDRAISIVERALEEFGAPIYVRHEVVHNKFVVDNLREKGAVFI
EDLAEVPPGATLVYSAHGVSKAVRQEAAERGFRVFDATCPLVTKVHKEVARLDAQDCEII
MIGHKGHVEVEGTMGQLAPGKMLLVETVGDVAKLEVRNPDKLAYVSQTTLSVDETKDIIA
ALNARFPNIRNPHKEDICYATTNRQTAVKELAEQCDIVIVVGSPNSSNSNRLREVAASRG
IDAYMVDNAGYLQRAWFEGKNKVGVTAGASAPEVLVREVLATIRGWGHETVREGEGAEES
IVFVLPKELRREGETKPDLCKR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaaaccatcatccttgccaatccgcgcggcttctgcgctggtgtggatcgg
gcaatcagtattgtcgaacgtgctttggaagagttcggcgcgccgatttatgtgcgccac
gaagtcgttcacaacaaattcgtcgtggacaacctgcgtgaaaaaggtgcggtgtttatt
gaagacttggcggaagtgccgccgggcgcgacactggtttattcggcacacggcgtatcg
aaggcggtgcggcaagaagcggcggagcgcggtttccgcgtgtttgatgcgacttgcccg
ctggtgacgaaagtgcataaggaagtcgcccgactggatgcccaagactgtgaaatcatc
atgatcgggcataaggggcacgtcgaggtcgaaggaacgatggggcagcttgcgccgggc
aaaatgcttttggtcgaaacggtcggagatgtggcaaaactcgaagtcagaaaccccgac
aaactcgcctatgtcagccaaaccacgctctcggtcgatgaaaccaaagacatcatcgcc
gcgctgaacgcgcgtttccccaatatccgcaatccgcacaaggaagatatctgctatgcg
acgaccaaccggcaaaccgccgtcaaagagttggcagaacagtgcgacatcgtgattgtg
gtcggttcgcccaattcgtccaacagcaaccgcttgcgcgaagtggcggcatcgcgcgga
atcgatgcgtatatggtggataatgcaggctacctgcaacgcgcatggtttgagggcaaa
aacaaagtcggcgtaacggcaggcgcgtccgcgcccgaagtgttggtgcgggaagtactg
gcaaccatacgcggatgggggcacgaaaccgtacgcgaaggcgagggtgcggaagaaagc
attgtgttcgtcctgcccaaagagttgcgccgcgagggcgaaaccaaacccgatttgtgc
aaacgttga

DBGET integrated database retrieval system