KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1834Help
Entry
NMB1834           CDS       T00027                                 

Gene name
ribF
Definition
(RefSeq) bifunctional riboflavin kinase/FMN adenylyltransferase
  KO
K11753  
riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NMB1834 (ribF)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     NMB1834 (ribF)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     NMB1834 (ribF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1933515..1934435)
Genome map
AA seq 306 aa AA seqDB search
MRIRLGRHNAPDFPQGAAVTIGNFDGVHLGHKHILQKLRLEADARGLPVVTVVFEPQPKE
FFALRTGRMPPCRISPLRTKLELLEGTGCVDAVWVLRFDQNFSEISAQGFIDRLLRQTLN
TRYLLVGDDFRFGAGREGCFELLAQQPDMQTERTPSVIVEDIRTSSTAVRQALSDGNLAY
AKKLLGHDYVLSGRVVHGRKLGRTLNAPTANIRLPRHRYALGGVFVVEADGAFGTRRGVA
SFGFNPTVDSGCSQKLEVHLFDFQGDLYGQGLNVRFLHKLRDEEKFDGMEELKRQIEADM
EAARRW
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcaggctggggcggcacaacgcgcccgactttccacagggtgccgccgtaacc
ataggcaatttcgacggcgtacacctcggacacaaacacatcctccaaaaactccgcctc
gaagccgacgcgcgcggactgcccgtcgtgaccgtcgttttcgaaccccaacccaaagaa
tttttcgcactccgcaccggcaggatgccaccgtgtcggatcagccccctgcgcaccaag
ctcgaattattggaaggcacaggctgtgtcgatgccgtctgggttttgcgtttcgatcaa
aatttttccgaaatatccgcgcaagggtttatcgaccgcctgctgcgtcaaaccttgaat
acgcgttatttgctcgtcggcgatgatttccgtttcggtgcggggcgggaaggctgtttt
gaacttttggcacaacagcccgatatgcagaccgagcgtacgccttccgtcatcgtcgaa
gacatccgcaccagcagtaccgccgtgcgacaagccctttcagacggcaaccttgcctat
gcgaaaaaacttttgggacacgactacgtcttgagcggcagggtggtgcacggcagaaaa
ctcggacgcaccttaaacgccccgactgccaacatccgcctgccccgccaccgttatgca
ctcggcggcgtgtttgtcgtcgaagcagacggcgcattcggcacgcggcgcggcgtggcg
agtttcggcttcaatcccaccgttgatagcggctgttctcaaaagcttgaagtccacctg
ttcgactttcaaggcgacctgtacggacaagggctgaacgtccgcttcctgcacaaactg
cgcgatgaggaaaagtttgacggtatggaagaactgaaaaggcagattgaagccgatatg
gaagccgcaaggcgttggtag

DBGET integrated database retrieval system