KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1839Help
Entry
NMB1839           CDS       T00027                                 

Gene name
fhs
Definition
(RefSeq) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00670  One carbon pool by folate
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
nme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NMB1839 (fhs)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     NMB1839 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-GeneID: 903260
NCBI-ProteinID: NP_274836
UniProt: Q9JXY2
Position
complement(1939771..1941447)
Genome map
AA seq 558 aa AA seqDB search
MSFKTDAEIAQSSTMRPIGEIAAKLGLNADNIEPYGHYKAKINPAEAFKLPQKQGRLILV
TAINPTPAGEGKTTVTIGLADALRHIGKDAVIALREPSLGPVFGVKGGAAGGGYAQVLPM
EDINLHFTGDFHAIGAANNLLAAMLDNHIYQGNELNIDPKRVLWRRVVDMNDRQLRNIID
GMGKPVDGVMRPDGFDITVASEVMAVFCLAKDISDLKERLGNILVAYAKDGSPVYAKDLK
ANGAMAALLKDAIKPNLVQTIEGTPAFVHGGPFANIAHGCNSVTATRLAKHLADYAVTEA
GFGADLGAEKFCDIKCRLAGLKPDAAVVVATVRALKYNGGVERANLGEENLDALEKGLPN
LLKHISNLKNVFGLPVVVALNRFVSDADAELAMIEKACAEHGVEVSLTEVWGKGGAGGAD
LARKVVNAIESQTNNFGFAYDVELGIKDKIRAIAQKVYGAEDVDFSAEASAEIASLEKLG
LDKMPICMAKTQYSLSDNAKLLGCPEDFRIAVRGITVSAGAGFIVALCGNMMKMPGLPKV
PAAEKIDVDAEGVIHGLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaaaaccgatgccgaaatcgcccaatcctccaccatgcgcccgattggcgaa
attgccgccaagcttggtctgaatgccgacaacattgagccttacggtcattacaaggcg
aaaatcaatcctgccgaagcgttcaaactgccgcaaaaacagggcaggctgattttggtt
accgccatcaacccgactccggcgggcgaaggcaaaaccaccgtaaccatcggtttggcg
gacgcgttgcgccacatcggcaaagatgccgtgattgccctgcgcgaaccttctctgggg
ccggtgttcggcgtgaaaggcggcgcggcaggcggcggctatgcccaagttttgccgatg
gaagacatcaacctgcacttcaccggagattttcacgccatcggtgcggcaaataatctg
cttgccgcgatgctcgacaaccatatctaccaaggcaacgagttgaacatcgaccccaaa
cgcgtgctgtggcggcgcgtggtcgatatgaacgaccgccagttgcgcaacatcatcgac
ggcatgggtaaacccgttgacggcgtgatgcgtcctgacggtttcgatattaccgttgct
tccgaagtgatggcggtattctgtcttgccaaagacatcagcgatttgaaagagcgtttg
ggcaacatccttgtcgcctacgccaaagacggcagccccgtttacgccaaagatttgaaa
gcgaatggcgcgatggcggcattgcttaaagatgcgattaagcccaacttggtgcaaacc
atcgaaggcacgcccgccttcgtacacggcggcccgttcgccaacatcgcccacggctgc
aactccgtaaccgcaacccgtctggcgaaacaccttgccgattacgccgtaaccgaagca
ggcttcggcgcggacttgggcgcggaaaaattctgcgacatcaaatgccgccttgccggt
ttgaaacctgatgcggctgttgtcgtggcgactgtccgcgcgttgaaatataacggcggc
gtggaacgcgccaacctcggcgaagaaaatttagacgctttggaaaaaggtttgcccaac
ctgctgaaacacatttccaacctgaaaaacgtattcggactgcccgtcgtcgttgcgctc
aaccgcttcgtgtccgacgccgatgccgagttggcgatgattgaaaaagcctgtgccgaa
cacggcgttgaagtttccctgaccgaagtgtggggcaaaggtggtgcgggcggcgcggat
ttggcgcgcaaagtcgtcaacgccattgaaagtcaaaccaataacttcggtttcgcctac
gatgtcgagttgggcatcaaagacaaaatccgtgcgattgcccaaaaagtgtacggcgcg
gaagatgttgatttcagcgcggaagcgtctgccgaaatcgcttcactggaaaaactgggc
ttggacaaaatgccgatctgcatggcgaaaacccaatactctttgagcgacaacgccaaa
ctgttgggctgccccgaagacttccgcatcgccgtgcgcggcatcaccgtttccgcaggc
gcaggtttcatcgtcgccctgtgcggcaacatgatgaaaatgcccggcctgcccaaagtt
ccggctgccgagaaaatcgatgtggacgcagaaggcgtgattcacggcttgttctga

DBGET integrated database retrieval system