KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1849Help
Entry
NMB1849           CDS       T00027                                 

Gene name
carA
Definition
(RefSeq) carbamoyl phosphate synthase small subunit
  KO
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB1849 (carA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB1849 (carA)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     NMB1849 (carA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1952630..1953763
Genome map
AA seq 377 aa AA seqDB search
MSTPALLVLADGSVFHGTSIGYEGSTSGEVVFNTSMTGYQEILTDPSYCKQIVTLTYPHI
GNTGTNAEDEESRSVYAAGLIIRDLPLLHSNFRASESLHDYLVRNKTVAIADIDTRRLTT
LLREKGAQGGAILTGADATIEKAQELIAAFGSMVGKDLAKEVSCTETYEWTEGEWALGKG
FVTPDEQPYHVVAYDFGVKTNILRMLASRGCRLTVVPAQTSAEDVLALNPDGVFLSNGPG
DPEPCTYAIKAVQKLIESGKPIFGICLGHQLISLAIGAKTLKMRFSHHGANHPVQDLDSG
KVVITSQNHGFAVDADTLPANARITHKSLFDNTLQGIELTDKPVFCFQGHPEASPGPQDV
GYLFDKFIGNMKAAKRA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccccgccctcctcgtcctcgctgacggcagcgtatttcacggcacatcaatc
ggttacgaaggttcgacttccggcgaagtcgtgttcaatacttcgatgaccggctatcag
gaaatcctgaccgacccgtcctactgcaaacaaatcgttaccctcacctacccacacatc
ggcaacaccggcaccaacgccgaagatgaagaaagccgcagcgtttatgccgccggcctg
attatccgcgacctgccgctcttgcacagcaacttccgcgcctccgaaagcctgcacgac
tatctggtacgcaacaaaaccgtcgccatcgccgacatcgacacccgccgcctgaccacg
ctgttgcgcgaaaaaggcgcgcaaggcggtgcgattctgaccggtgcggatgccacaatc
gaaaaagcgcaagaactcatcgccgcgttcggcagcatggtcggaaaagatttggcaaaa
gaagtttcctgcacggaaacttacgaatggacggaaggcgaatgggcattgggcaagggt
ttcgttacccctgacgaacagccttaccacgtcgtcgcctacgatttcggcgtgaaaacc
aacatcctgcgtatgctcgcctcgcgcggctgccgcctgaccgtcgtccccgcccaaacg
agcgcggaagacgtgttggcactcaaccctgacggcgtattcctatccaacggccccggc
gaccccgagccttgcacctacgccatcaaagccgtacaaaaactgatagaaagcggcaaa
ccgatttttggcatttgcttgggacaccagctcatcagcctcgccatcggcgcgaaaacc
ctgaaaatgcgcttcagccaccacggtgcgaaccaccctgtgcaagatttggacagcggc
aaagtcgtcatcaccagccaaaaccacggttttgccgttgatgccgacaccctgcccgct
aacgcacgcattacccacaaatccttgtttgacaacactttgcaaggcatcgagctgacc
gacaaacctgtgttctgcttccaaggccaccccgaagccagccccggtccgcaagatgtc
ggctatttgtttgacaaattcattggcaatatgaaagcggcaaaacgggcataa

DBGET integrated database retrieval system