KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1864Help
Entry
NMB1864           CDS       T00027                                 

Gene name
hemL
Definition
(RefSeq) glutamate-1-semialdehyde aminotransferase
  KO
K01845  
glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMB1864 (hemL)
Enzymes [BR:nme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     NMB1864 (hemL)
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class III
   NMB1864 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1967566..1968849)
Genome map
AA seq 427 aa AA seqDB search
MNRNEILFDRAKAIIPGGVNSPVRAFGSVGGVPRFIKKAEGAYVWDENGTRYTDYVGSWG
PAIVGHAHPEVVETVCEAALGGLSFGAPTEGEIVIAEEIAKIMPSVERLRLVSSGTEATM
TAIRLARGFTGRDKIIKFEGCYHGHSDSLLVKAGSGLLTFGNPSSAGVPADFTKHTLVLE
YNNIAQLEEAFAQSGNEIACVIVEPFVGNMNLVRPTEAFVKALRGLTEKYGAVLIYDEVM
TGFRVALGGAQSLHGITPDLTTMGKVIGGGMPLAAFGGRKDIMECISPLGGVYQAGTLSG
NPIAVAAGLKTLEIIQREGFYENLTARTEQLVQGFRTAADAAGIEFTADSVGGMFGLYFA
AHAPRNYADMARSNIEGFKQFFHGMLDRNVAFGPSAYEAGFVSAAHTPELIDETVAVAVE
VFKAMAE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtaacgaaattttattcgaccgcgccaaagccatcatccccggcggcgtgaat
tcccccgtccgcgcattcggcagcgtcggcggcgtaccgcgctttatcaaaaaagccgaa
ggcgcgtatgtttgggacgaaaacggcacgcgctataccgattacgtcggctcgtgggga
cctgcgattgtcggacacgcgcaccccgaagtcgtcgaaaccgtatgcgaagccgcattg
ggcggtttgtcgttcggcgcgcctaccgaaggcgaaatcgtcattgccgaagaaatcgcc
aaaatcatgccgtccgtcgaacggctgcgcctcgtcagctccggtaccgaagcgaccatg
accgccatccgtctggcacgcggttttaccgggcgtgacaaaatcatcaagtttgaaggc
tgctaccacgggcattccgacagcctgctggtgaaagccggcagcggtctgctgacgttt
ggcaacccgtcttccgccggtgtgcctgccgactttaccaaacacactttggtactcgag
tacaacaatatcgcccaactcgaagaagcctttgctcaaagcggcaatgaaatcgcctgc
gtgattgtcgaacccttcgtcggcaatatgaacctcgtccgcccgaccgaagcctttgtc
aaagccttgcgcggattgaccgaaaaatacggcgcggtgttgatttacgacgaagtgatg
accggcttccgcgtcgcgctcggcggcgcgcaatctttgcacggcatcacgcccgacctg
accacgatgggcaaagtcatcggcggcggtatgccgcttgccgcgtttggcgggcgcaaa
gacattatggaatgtatttccccgctgggcggcgtgtatcaggcaggcaccttgtcgggc
aacccgattgctgtcgccgcaggcttgaaaacgctggaaatcatccagcgcgaaggcttc
tatgaaaacctgacggcgcgtaccgaacagttggttcaaggttttcggacggcagcggat
gcggcgggcatcgagttcaccgccgacagcgtgggcggtatgttcggtctgtatttcgcc
gcacacgcgccgcgaaactatgccgatatggcgcgttccaatattgaaggcttcaaacag
tttttccacgggatgctcgaccgcaatgtcgccttcggcccgtccgcttatgaagcaggt
ttcgtttccgccgcgcatacgcccgagctgattgacgaaacggttgcggttgcggttgaa
gtgttcaaggcgatggctgaatga

DBGET integrated database retrieval system