KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1867Help
Entry
NMB1867           CDS       T00027                                 

Gene name
dxs
Definition
(RefSeq) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  
1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Thiamine metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NMB1867 (dxs)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB1867 (dxs)
Enzymes [BR:nme01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     NMB1867 (dxs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1971047..1972960)
Genome map
AA seq 637 aa AA seqDB search
MNPSPLLDLIDSPQDLRRLDKKQLPRLAGELRTFLLESVGQTGGHFASNLGAVELTIALH
YVYDTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGLAGFPKRCESEYDAFGVGHSS
TSIGAALGMAAADKLLGSDRRSVAIIGDGAMTAGQAFEALNCAGDMDVDLLVVLNDNEMS
ISPNVGALPKYLASNVVRDMHGLLSTVKAQTGKVLDKIPGAMEFAQKVEHKIKTLAEEAE
HAKQSLSLFENFGFRYTGPVDGHNVENLVDVLKDLRSRKGPQLLHVITKKGNGYKLAEND
PVKYHAVANLPKESAAQMPSEKEPKPAAKPTYTQVFGKWLCDRAAADSRLVAITPAMREG
SGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLACEGMKPVVAIYSTFLQRAYDQLVHDIAL
QNLPVLFAVDRAGIVGADGPTHAGLYDLSFLRCVPNMIVAAPSDENECRLLLSTCYQADA
PAAVRYPRGTGTGAPVSDGMETVEIGKGIIRREGEKTAFIAFGSMVAPALAVAEKLNATV
ADMRFVKPIDEELIVRLARSHDRIVTLEENAEQGGAGGAVLEVLAKHGICKPVLLLGVAD
TVTGHGDPKKLLDDLGLSAEAVERRVRAWLSDRDAAN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaagccccctactcgacctgattgacagcccgcaagatttgcgccgtctggac
aaaaaacagctgccgcgccttgccggcgagttgcgcacctttctgctggaatctgtcggg
cagaccggcgggcatttcgccagcaatttgggcgcggtcgaactgaccatcgccctgcac
tatgtgtacgacacgcccgaagacaagctggtgtgggatgtcggacaccaaagctatccg
cacaaaatcctgacaggcaggaaaaaccagatgcacaccatgcgccaatatggcggtttg
gcgggttttccgaaacgttgcgagtccgagtacgacgcgttcggcgtggggcattcctcc
acctccatcggcgcggcgttgggcatggcggcggcagacaaactcttgggcagcgaccgc
cgcagcgtcgccatcatcggcgacggcgcgatgacggcggggcaggcgtttgaagccttg
aattgcgcaggcgatatggatgtggatttgctggtcgtcctcaacgacaacgaaatgtcg
atttcccccaacgtcggcgcgctgccgaaataccttgccagcaacgtcgtgcgcgatatg
cacggcctgttgagtaccgtcaaagcgcaaacgggcaaggtattagacaaaatacccggc
gcgatggagtttgcccaaaaagtcgaacacaaaatcaaaacccttgccgaagaagccgaa
cacgccaaacagtcgctgtctttgtttgaaaacttcggcttccgctacaccggccccgtg
gacggacacaacgtcgaaaatctggtggacgtattgaaagacttgcgcagccgcaaaggc
cctcagttgctgcacgtcatcaccaaaaagggcaacggctacaaactcgccgaaaacgac
cccgtcaaataccacgccgtcgccaacctgcctaaagaaagcgcggcgcaaatgccgtct
gaaaaagaacccaagcccgccgccaaaccgacctatacccaagtgttcggcaaatggctg
tgcgaccgggcggcggcagattcccgactggttgcgattacccccgccatgcgcgagggc
agcggcttggttgagtttgaacaacgattccccgaccgctatttcgatgtcggcatcgcc
gagcagcacgccgttacctttgccggcggtttggcttgcgaagggatgaagcccgtcgtg
gcgatttattccacctttttacaacgcgcctacgaccaactggtgcacgacatcgccctg
caaaacctacccgttttgtttgccgtcgaccgcgcgggcatcgtcggcgcggacggcccg
acccatgccggtctgtacgatttgagctttttgcgctgcgtgccgaacatgattgtcgcc
gcgccgagcgatgaaaacgaatgccgcctgttgctttcgacctgctatcaggcagacgcg
cccgccgccgtccgctatccgcgcggcacgggtacgggcgcgccggtttcagacggcatg
gaaaccgtggaaatcggcaagggcattatccgccgcgaaggtgagaaaaccgcattcatt
gccttcggcagtatggtcgcccccgcattggcggttgccgaaaaactgaacgccaccgtc
gccgatatgcgcttcgtcaaaccgatagacgaagagttgattgtccgccttgcccgaagc
cacgaccgcatcgttacccttgaagaaaacgccgaacagggcggcgcaggcggcgcggtg
ctggaagtattggcgaaacacggcatctgcaaacccgttttgcttttgggcgttgccgat
accgtaaccggacacggcgatccgaaaaaacttttagacgatttgggcttgagtgccgaa
gcggtggaacggcgtgtgcgcgcgtggctgtcggatcgggatgcggcaaattaa

DBGET integrated database retrieval system