KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1869Help
Entry
NMB1869           CDS       T00027                                 

Gene name
cbbA
Definition
(RefSeq) fructose-1,6-bisphosphate aldolase
  KO
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMB1869 (cbbA)
   01230 Biosynthesis of amino acids
    NMB1869 (cbbA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1869 (cbbA)
   00030 Pentose phosphate pathway
    NMB1869 (cbbA)
   00051 Fructose and mannose metabolism
    NMB1869 (cbbA)
  Energy metabolism
   00680 Methane metabolism
    NMB1869 (cbbA)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     NMB1869 (cbbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1974134..1975198
Genome map
AA seq 354 aa AA seqDB search
MALVSMRQLLDHAAENSYGLPAFNVNNLEQMRAIMEAADQVDAPVIVQASAGARKYAGAP
FLRHLILAAVEEFPHIPVVMHQDHGASPDVCQRSIQLGFSSVMMDGSLMEDGKTPSSYEY
NVNATRTVVNFSHACGVSVEGEIGVLGNLETGEAGEEDGVGAVGKLSHDQMLTSVEDAVC
FVKDTGVDALAIAVGTSHGAYKFTRPPTGDVLRIDRIKEIHQALPNTHIVMHGSSSVPQE
WLKVINEYGGNIGETYGVPVEEIVEGIKHGVRKVNIDTDLRLASTGAVRRYLAENPSDFD
PRKYLSKTIEAMKQICLDRYLAFGCEGQAGKIKPVSLEKMASRYAKGELNQIVK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcactcgtatccatgcgccaactgcttgatcatgctgccgaaaacagctacggcctg
ccggcgttcaacgtcaacaacctcgaacagatgcgcgccatcatggaggctgcagaccaa
gtcgacgcccccgtcatcgtacaggcgagtgccggtgcgcgcaaatatgcgggtgcgccg
tttttacgccacctgattttggcggctgtcgaagaatttccacacatccccgtcgtcatg
caccaagaccacggcgcatcacccgacgtgtgccaacgctccatccaactgggcttctcc
tctgtaatgatggacggctcgctgatggaagacggcaaaaccccttcttcttacgaatac
aacgtcaacgccacacgtaccgtggttaacttctcccacgcttgcggcgtatccgttgaa
ggcgaaatcggcgtattgggcaacctcgaaaccggcgaagcaggcgaagaagacggtgta
ggcgcagtgggcaaactttcccacgaccaaatgctgaccagcgtcgaagatgccgtatgt
ttcgttaaagataccggcgttgacgcattggctattgccgtcggcaccagccacggcgca
tacaaattcacccgtccgcccacaggcgatgtattacgtatcgaccgcatcaaagaaatc
caccaagccctgcccaatacacacatcgtgatgcacggctccagctccgttccgcaagaa
tggctgaaagtcatcaacgaatacggcggcaatatcggcgaaacctacggcgtgccggtt
gaagaaatcgtcgaaggcatcaaacacggcgtgcgcaaagtcaacatcgataccgacttg
cgccttgcttctaccggcgcggtacgccgctaccttgccgaaaatccgtccgactttgac
ccgcgcaaatacctgagcaaaaccattgaggccatgaagcaaatctgcctcgaccgttat
cttgcgtttggctgcgaaggtcaggcaggcaaaatcaaacctgtttcgttggaaaaaatg
gcaagccgttatgccaagggcgaattgaaccaaatcgtcaaataa

DBGET integrated database retrieval system