KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1874Help
Entry
NMB1874           CDS       T00027                                 

Gene name
pyrE
Definition
(RefSeq) orotate phosphoribosyltransferase
  KO
K00762  
orotate phosphoribosyltransferase [EC:2.4.2.10]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB1874 (pyrE)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.10  orotate phosphoribosyltransferase
     NMB1874 (pyrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1978234..1978875
Genome map
AA seq 213 aa AA seqDB search
MTDFRQDFLKFSLAQNVLKFGEFTTKAGRRSPYFFNAGLFNDGLSTLQLAKFYAQSIIES
GIRFDMLFGPAYKGIILAAATAMMLAEKGVNVPFAYNRKEAKDHGEGGVLVGAPLKGRVL
IIDDVISAGTSVRESIKLIEAEGATPAGVAIALDRMEKGTGELSAVQEVEKQYGLPVAPI
ASLNDLFILLQNNPEFGQFLEPVRAYRRQYGVE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttccgccaagatttcctcaaattctccctcgcccaaaatgttttgaaattc
ggcgaatttaccaccaaggcaggacggcggtcgccctatttcttcaatgccggcctcttt
aacgacggcttgtccacgctgcaactggcaaaattttacgcacaatccatcattgaaagc
ggcatccgattcgatatgctgttcggtcccgcctacaaaggcattattttggcggcggca
accgcgatgatgctggcggaaaaaggcgtgaacgtcccgtttgcctacaaccgcaaagaa
gccaaagaccacggcgaaggcggcgtgttggtcggcgcgccgcttaaagggcgcgtgctg
attatcgacgacgtgatttccgccggcacatccgtacgcgaatcgatcaaactgattgaa
gcggagggtgcaacccccgccggtgtcgccatcgcgctcgatcgcatggaaaaaggcacg
ggtgaattgagcgcggttcaggaagtggaaaaacaatacggtctgcccgtcgcccccatc
gccagcctgaacgatttgtttattctgttgcaaaacaaccccgaattcggacagttcctc
gaacccgtccgagcctaccgtcggcagtacggcgtagaataa

DBGET integrated database retrieval system