KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1885Help
Entry
NMB1885           CDS       T00027                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NMB1885 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1989168..1989824)
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALAEIPRELFVDEDLQGLAYADMALPLANGHKM
LEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGRVVSDDIDVEQQNRAKAVLD
GLGLDNIDYVQNNGLTELSAGAPFDAVYVGGAVNLVPEVLKEQLKDGGRMVVIVGRKPVQ
RALLITRRGDVFEEKVLFDTLVAHLDDKDADPFGGFDF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcaaatccgtccgtgggatgta
ttggattttgatgtgttggacgctttggcggagattccgcgcgagctttttgtcgatgag
gacttgcagggtttggcgtatgcggatatggcgctgccgcttgccaacggtcataagatg
ctcgagccgaaagtcgtggcgcggctggcgcagggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggttcgggctatgcgaccgcgctgttggcaaaattggctggt
cgtgtggtgtcggacgacatcgatgtcgaacagcaaaaccgcgccaaagcggtgttggac
ggcttgggtttggacaatatcgattatgtgcaaaacaacgggttgaccgaactttccgca
ggtgcgccgtttgatgcggtttatgtcggcggtgcggtaaaccttgtgcctgaagtgttg
aaagaacagttgaaagatggcggacgcatggtggttatcgtaggtcgcaagcctgttcaa
cgcgcgcttttgattacgcgcaggggcgatgtgtttgaagagaaggtgctgttcgatacc
ttggtggcgcatttggatgataaggatgccgatccgtttggcggtttcgatttttaa

DBGET integrated database retrieval system