KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1918Help
Entry
NMB1918           CDS       T00027                                 

Gene name
fabD
Definition
(RefSeq) ACP S-malonyltransferase
  KO
K00645  
[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NMB1918 (fabD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB1918 (fabD)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     NMB1918 (fabD)
Lipid biosynthesis proteins [BR:nme01004]
 Fatty acid synthase
  Component type
   NMB1918 (fabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2015482..2016408
Genome map
AA seq 308 aa AA seqDB search
MSFAFFFPGQGSQSLGMMNGFAEHAIVKNTFAEASAILGQDLWAMINGSDAEIIGQTVNT
QPIMLAAGVAVYRAYLEAGGKTPAAVAGHSLGEYTALVAAGALNFADAVKLVRLRAELMQ
SAVPQGVGAMAAILGLEDEQVKAICAEAAQSEVVEAVNFNSPGQIVIAGNAAAVGRAMAA
AKEAGAKRALPLPVSVPSHCSLMKPAADKLAEALKTVEIKQPQIRVIHNADVAAYDDADK
IKDALVRQLYSPVRWTETVNALVSDGIAESAECGPGKVLAGLAKRINKAAACSALTDAGQ
VAAFIEAH
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgccttcttttttcccggacaaggttcccaaagcctcggtatgatgaacggc
tttgccgaacacgccatcgtcaaaaacacctttgccgaagcctccgccatattggggcag
gacttgtgggcgatgataaacggcagcgatgccgaaatcatcggtcaaaccgtcaacacc
cagcccattatgctcgccgccggcgttgccgtttaccgcgcctatttagaagcgggcggc
aaaacgcctgccgccgttgccggacacagcctcggcgaatacaccgcactcgttgccgcc
ggcgcattgaattttgccgacgcggtcaaactcgtgcgcctgcgcgccgaactgatgcag
tccgccgtaccgcaaggcgtgggcgcaatggcggcgattctcggcttggaagatgagcag
gttaaagccatttgtgccgaagccgcccaaagcgaagtggtcgaagccgtcaacttcaac
tcacccggacaaatcgtgattgcaggcaacgccgccgccgtcggacgcgccatggctgcc
gccaaagaagccggtgccaaacgcgccctgccgctgcccgtgtccgtaccttcccattgc
agcctgatgaaacccgccgccgacaaacttgccgaagccctgaaaaccgttgaaatcaag
cagccgcaaatccgcgttatccacaacgccgacgttgccgcctacgatgatgccgacaaa
atcaaagacgcgctcgtccgccagctttacagccccgtacgctggacggaaaccgtcaac
gccctcgtttcagacggcattgccgaatccgccgaatgcggcccgggcaaagtgttggcg
ggcttggcaaaacgcatcaacaaagccgccgcgtgcagcgcactgaccgatgccggacag
gttgccgcctttatcgaagcgcactga

DBGET integrated database retrieval system