KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1919Help
Entry
NMB1919           CDS       T00027                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K11085  
ATP-binding cassette, subfamily B, bacterial MsbA [EC:3.6.3.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:nme00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    NMB1919
Enzymes [BR:nme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     NMB1919
Transporters [BR:nme02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    NMB1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2016546..2018411
Genome map
AA seq 621 aa AA seqDB search
MIEKLTFGLFKKEDARSFMRLMAYVRPYKIRIVAALIAIFGVAATESYLAAFIAPLINHG
FSAPAAPPELSAAAGIISTLQNWREQFTYMVWGTENKIWTVPLFLIILVVIRGICRFTST
YLMTWVSVMTISKIRKDMFAKMLTLSSRYHQETPSGTVLMNMLNLTEQSVSNASDIFTVL
TRDTMIVTGLTIVLLYLNWQLSLIVVLMFPLLSLLSRYYRDRLKHVISDSQKSIGTMNNV
IAETHQGHRVVKLFNGQAQAANRFDAVNRTIVRLSKKITQATAAHSPFSELIASIALAVV
IFIALWQSQNGYTTIGEFMAFIVAMLQMYAPIKSLANISIPMQTMFLAADGVCAFLDTPP
EQDKGTLAPQRVEGRISFRNVDVEYRSDGIKALDNFNLDIRQGERVALVGRSGSGKSTVV
NLLPRFVEPSAGNICIDGIDIADIKLDCLRAQFALVSQDVFLFDDTLFENVRYSRPDAGE
AEVLFALQTANLQSLIDSSPLGLHQPIGSNGSNLSGGQRQRVAIARAILKDAPILLLDEA
TSALDNESERLVQQALERLMENRTGIIVAHRLTTIEGADRIIVMDDGKIIEQGTHEQLMS
QNGYYTMLRNISNKDAAVRTA
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaaactgactttcggactgtttaaaaaagaagacgcgcgcagctttatgcgc
ctgatggcgtacgtccgcccctacaaaatccgcatcgttgccgccctgattgccattttc
ggcgttgccgccaccgaaagctaccttgccgccttcatcgcccccctgattaaccacggc
ttttccgcacctgccgcgccgcccgagctgtctgccgccgccggcatcatttccaccctg
caaaactggcgcgaacagtttacctatatggtttgggggacggaaaacaaaatctggacc
gtcccgctcttcctcatcatcctcgtcgtcatccgtggcatctgccgctttaccagcacc
tatctgatgacttgggtctccgtgatgaccatcagcaaaatccgcaaagatatgtttgcc
aaaatgctgaccctttcctcccgctaccatcaggaaacgccgtccggcaccgtactgatg
aatatgctcaacctgaccgaacagtcggtcagcaacgccagcgacatcttcaccgtcctc
acgcgcgacacgatgatcgttaccggcctgaccatcgtcctgctttacctcaactggcag
ctcagcctcatcgtcgtcctgatgttccccctgctctccctgctctcgcgctactaccgc
gaccgtctgaaacacgtcatttccgactcgcaaaaaagcataggcacgatgaacaacgtg
attgccgaaacccatcagggacaccgcgtcgtcaagctgttcaacgggcaggcgcaggcg
gcaaaccggttcgacgcggtcaaccgcaccatcgtccgcctcagcaaaaaaatcacgcag
gcaacggcggcacattccccgttcagcgaactgatcgcctcgatcgccctcgccgtcgtc
atcttcatcgccctgtggcaaagccaaaacggctacaccaccatcggcgaatttatggca
ttcatcgtcgcgatgctgcaaatgtacgcccccatcaaaagccttgccaacatcagcatc
cctatgcagacgatgttcctcgccgccgacggtgtatgtgcatttctcgacaccccgccc
gaacaggacaagggcacgctcgcaccgcagcgtgtcgaagggcgcatcagcttccgcaac
gtcgatgtcgaataccgttcagacggcatcaaagccctcgacaacttcaacctcgacatc
agacaaggcgaacgcgtcgccctggtcggacgttccggcagcggcaaatccaccgtcgtc
aacctgctgccccgctttgtcgaaccgtctgccggcaacatctgcatagacggtatcgac
atcgccgacatcaaactcgactgcctgcgcgcccaattcgccctcgtctcccaagacgta
ttcctgtttgacgacaccctgtttgaaaacgtccgatacagccgtcccgacgcgggcgaa
gccgaagtcctgttcgccctccaaaccgccaacctgcaaagcctgattgacagctccccg
ctcggactgcaccagcccatcggatcgaacggcagcaacttatccggcggacagcggcaa
cgcgtcgccattgcccgcgccattttgaaagacgcgccgatattattattggacgaagcc
accagcgcattagacaacgaatccgaacgcctcgtccaacaggcgctcgaacgcctgatg
gaaaaccgcaccggcatcatcgtcgcccaccgcctgaccaccatcgaaggggccgaccgc
atcatcgtgatggacgacggcaaaatcatcgaacaaggcacacacgaacaactgatgtcc
caaaacggttactacacgatgttacgcaatatctcaaacaaagatgccgccgtccggacg
gcataa

DBGET integrated database retrieval system