KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1921Help
Entry
NMB1921           CDS       T00027                                 

Gene name
fabG
Definition
(RefSeq) 3-ketoacyl-ACP reductase
  KO
K00059  
3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Fatty acid biosynthesis
Biotin metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB1921 (fabG)
   01040 Biosynthesis of unsaturated fatty acids
    NMB1921 (fabG)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB1921 (fabG)
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    NMB1921 (fabG)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     NMB1921 (fabG)
Lipid biosynthesis proteins [BR:nme01004]
 Fatty acid synthase
  Component type
   NMB1921 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2020138..2020884
Genome map
AA seq 248 aa AA seqDB search
MSTQDLNGKIALVTGASRGIGAAIADTLAAAGAKVIGTATSESGAAAISERLAQWGGEGR
VLNSAEPETIESLIADIEKAFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFR
ASKAVLRGMMKQRSGRIINITSVVGVMGNAGQTNYAAAKAGLIGFSKSMAREVGSRGITV
NCVAPGFIDTDMTRALPEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLH
VNGGMLMP
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacaagatttaaacggcaaaatcgctttggtaacaggcgcatcgcgcggtatc
ggtgcagcaattgccgacacgctggcggcagccggtgccaaagtcatcggtacggcgacc
agtgagagcggtgcggcggcgattagcgagcggttggcgcaatggggcggcgaaggccgc
gtattaaattccgccgaacctgaaaccatcgaaagcctgattgccgacatcgaaaaagcg
ttcggcaaactcgatattctggtcaacaacgccggcatcacccgcgacaacctcctgatg
cgcatgaaagaagaagagtgggacgacatcatgcaggtcaacctcaaatccgtgttccgc
gcttctaaagccgttttgcgcggtatgatgaaacaacgttccggccgcatcatcaacatc
acatccgtcgtcggcgtgatgggcaatgccggtcaaaccaactatgccgcggcaaaagca
ggcttaatcggtttctccaaatccatggcgcgcgaagtcggcagccggggcattaccgtc
aactgcgtcgcccctggctttatcgataccgacatgacacgcgccctgccggaagaaacc
cgccaaacctttaccgcccaaaccgccttgggcagattcggcgacgcgcaagacatcgcc
gatgcggttctgttcctcgcttccgaccaagcaaaatacatcaccggccaaacgctgcac
gtcaacggcggtatgctgatgccttaa

DBGET integrated database retrieval system