KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1928Help
Entry
NMB1928           CDS       T00027                                 

Gene name
lgtB
Definition
(RefSeq) lacto-N-neotetraose biosynthesis glycosyl transferase LgtB
  KO
K07270  
glycosyl transferase, family 25
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2025870..2026697)
Genome map
AA seq 275 aa AA seqDB search
MQNHVISLASAAERRAHIADTFGRHGIPFQFFDALMPSERLEQAMAELVPGLSAHPYLSG
VEKACFMSHAVLWKQALDEGLPYITVFEDDVLLGEGAEKFLAEDAWLQERFDPDTAFIVR
LETMFMHVLTSPSGVADYCGRAFPLLESEHWGTAGYIISRKAMRFFLDRFAALPPEGLHP
VDLMMFSDFFDREGMPVCQLNPALCAQELHYAKFHDQNSALGSLIEHDRLLNRKQQRRDS
PANTFKHRLIRALTKISREREKRRQRREQFIVPFQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaccacgttatcagcttagcttccgccgcagaacgcagggcgcacattgccgat
accttcggcaggcacggcatcccgtttcagtttttcgacgcactgatgccgtctgaaagg
ctggaacaggcaatggcggaactcgtccccggcttgtcggcgcacccctatttgagcgga
gtggaaaaagcctgctttatgagccacgccgtattgtggaagcaggcattggacgaaggt
ctgccgtatatcaccgtatttgaggacgacgttttactcggcgaaggtgcggaaaaattc
cttgccgaagacgcttggctgcaagaacgctttgacccggataccgcctttatcgtccgc
ttggaaacgatgtttatgcacgtcctgacctcgccctccggcgtggcggattactgcggg
cgcgcctttccgctgttggaaagcgaacactgggggacggcgggctatatcatttcccga
aaagcgatgcggtttttcctggacaggtttgccgccctgccgcccgaagggctgcacccc
gtcgatctgatgatgttcagcgattttttcgacagggaaggaatgccggtttgccagctc
aatcccgccttgtgcgcccaagagctgcattatgccaagtttcacgaccaaaacagcgca
ttgggcagcctgatcgaacacgaccgcctcctgaaccgcaaacagcaaaggcgcgattcc
cccgccaacacattcaaacaccgcctgatccgcgccttgaccaaaatcagcagggaaagg
gaaaaacgccggcaaaggcgcgaacagttcattgtgcctttccaataa

DBGET integrated database retrieval system