KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1929Help
Entry
NMB1929           CDS       T00027                                 

Gene name
lgtA
Definition
(RefSeq) lacto-N-neotetraose biosynthesis glycosyl transferase
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2026739..2027788)
Genome map
AA seq 349 aa AA seqDB search
MPSEAFRRHRAYRENKLQPLVSVLICAYNVEKYFAQSLAAVVNQTWRNLDILIVDDGSTD
GTLAIAQRFQEQDGRIRILAQPRNSGLIPSLNIGLDELAKSGGGGEYIARTDADDIAAPD
WIEKIVGEMEKDRSIIAMGAWLEVLSEEKDGNRLARHHEHGKIWKKPTRHEDIADFFPFG
NPIHNNTMIMRRSVIDGGLRYNTERDWAEDYQFWYDVSKLGRLAYYPEALVKYRLHANQV
SSKYSIRQHEIAQGIQKTARNDFLQSMGFKTRFDSLEYRQIKAVAYELLEKHLPEEDFER
ARRFLYQCFKRTDTLPAGAWLDFAADGRMRRLFTLRQYFGILHRLLKNR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaagccttcagacggcatcgtgcctatcgggagaataaattgcagccttta
gtcagcgtattgatttgcgcctacaacgtagaaaaatatttcgcccaatcattagccgcc
gtcgtgaatcaaacttggcgcaacttggatattttgattgtcgatgacggctcgacggac
ggtacgcttgccattgcccagcgtttccaagaacaggacggccgcatccgcatcctcgcg
cagccgcgcaattccggtctgattccctctttaaacatcgggctggatgaattggcaaag
tcggggggggggggggaatatattgcgcgcaccgatgcagacgatattgccgcccccgac
tggattgagaaaatcgtgggtgagatggaaaaagaccgcagcatcatcgcgatgggtgcg
tggctggaagttttgtcggaagaaaaggacggcaaccggctggcgcggcaccacgaacac
ggcaaaatttggaaaaaaccgacccgacacgaagacattgccgactttttccctttcggc
aaccccatacacaacaacacgatgattatgaggcgcagcgtcattgacggcggtttgcgt
tacaacaccgagcgggattgggcggaagattaccaattttggtacgatgtcagcaaattg
ggcaggctggcttattatcccgaagccttggtcaaataccgccttcacgccaatcaggtt
tcatccaaatacagcatccgccaacacgaaatcgcgcaaggcatccaaaaaaccgccaga
aacgattttttgcagtctatgggttttaaaacccggttcgacagccttgaataccgccaa
ataaaagcagtagcgtatgaattgctggagaaacatttgccggaagaagattttgaacgc
gcccgccggtttttgtaccaatgcttcaaacggacggacacgctgcccgccggcgcgtgg
ctggattttgcggcagacggcaggatgcggcggctgtttaccttgaggcaatacttcggc
attttgcaccgattgctgaaaaaccgttga

DBGET integrated database retrieval system