KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1938Help
Entry
NMB1938           CDS       T00027                                 

Gene name
atpF
Definition
(RefSeq) ATP synthase F0F1 subunit B
  KO
K02109  
F-type H+-transporting ATPase subunit b
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    NMB1938 (atpF)
Photosynthesis proteins [BR:nme00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   NMB1938 (atpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2036548..2037018)
Genome map
AA seq 156 aa AA seqDB search
MNINATLFAQIIVFFGLVWFTMKFVWPPIAKALDERAAKVAEGLAAAERGKSDFEQAEKK
VAELLAEGRNQVSEMVANAEKRAAKIVEEAKEQASSEAARIAAQAKADVEQELFRARESL
REQVAVLAVKGAESILRSEVDASKHAKLLDTLKQEL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatcaatgcaacattattcgctcaaatcatcgtctttttcggtttggtatggttt
accatgaaattcgtgtggccgccgattgcaaaagctttggatgagcgtgccgcaaaagtc
gccgaaggcttggctgccgccgagcgtggtaaaagcgattttgagcaggctgaaaaaaag
gttgcagaactcttggcagaagggcgtaatcaggtttccgaaatggttgccaacgccgaa
aaacgtgccgccaaaattgtcgaagaagccaaagaacaggcttcttccgaggcggcgcgc
attgcagctcaggcaaaggccgatgtggagcaggaattgttccgcgcacgcgaatccctg
cgcgagcaggttgccgtgttggctgtcaaaggtgccgaatctattttgcgcagcgaagtc
gatgcttccaaacacgcaaaactgctcgataccctgaaacaggagctgtaa

DBGET integrated database retrieval system