KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1938Help
Entry
NMB1938           CDS       T00027                                 

Gene name
atpF
Definition
(RefSeq) ATP synthase F0F1 subunit B
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00190  Oxidative phosphorylation
nme01100  Metabolic pathways
Module
nme_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    NMB1938 (atpF)
Photosynthesis proteins [BR:nme00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   NMB1938 (atpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_B DUF2774 Fibin DUF1514 HrpE DUF883 REF
Motif
Other DBs
NCBI-GeneID: 904214
NCBI-ProteinID: NP_274932
UniProt: Q7DD66
Position
complement(2036548..2037018)
Genome map
AA seq 156 aa AA seqDB search
MNINATLFAQIIVFFGLVWFTMKFVWPPIAKALDERAAKVAEGLAAAERGKSDFEQAEKK
VAELLAEGRNQVSEMVANAEKRAAKIVEEAKEQASSEAARIAAQAKADVEQELFRARESL
REQVAVLAVKGAESILRSEVDASKHAKLLDTLKQEL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatcaatgcaacattattcgctcaaatcatcgtctttttcggtttggtatggttt
accatgaaattcgtgtggccgccgattgcaaaagctttggatgagcgtgccgcaaaagtc
gccgaaggcttggctgccgccgagcgtggtaaaagcgattttgagcaggctgaaaaaaag
gttgcagaactcttggcagaagggcgtaatcaggtttccgaaatggttgccaacgccgaa
aaacgtgccgccaaaattgtcgaagaagccaaagaacaggcttcttccgaggcggcgcgc
attgcagctcaggcaaaggccgatgtggagcaggaattgttccgcgcacgcgaatccctg
cgcgagcaggttgccgtgttggctgtcaaaggtgccgaatctattttgcgcagcgaagtc
gatgcttccaaacacgcaaaactgctcgataccctgaaacaggagctgtaa

DBGET integrated database retrieval system